(data stored in ACNUC7421 zone)

EMBL: CP002160.PE67

CP002160.PE67        Location/Qualifiers
FT   CDS_pept        118478..119518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0069"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M42 family protein; KEGG:
FT                   cac:CAC0214 aminopeptidase M42 family endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49858"
FT                   /db_xref="GOA:D9SMS3"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS3"
FT                   /inference="protein motif:PFAM:PF05343"
FT                   /protein_id="ADL49858.1"
FT                   /translation="MNYQLLLRELCSENAPSGLEFKLHPIMEKNFGYIKDLEISKDENY
FT                   NLYINKKGKRNGTIMIMAHSDEISLVITEVIEGGFLRFKAIGMDANILLGQEVAIHGCE
FT                   VINGVIGGIPKSKTDDNILKKAVVTSDLFIDTGYPKEYLEEVIKIGDRATLIGEYKNLL
FT                   RNTISSKAIDDRAGILSMLICAQELKEHELDVVFVCSCQEELGHRGAKMASYKVKPNLA
FT                   IAIDVTFDNGEFGDRDRENKLGNGPIICIGPNNHPRMIKKLKEVARKYYIPFGVEVEPG
FT                   NTGSDAWDIQVSRGGIPTVLVSIPIKYMHTSVETANLGDIKNTGRLVARFIEEIKLLDL
FT                   EELTCF"
     atgaattatc agttattact aagagaactg tgtagtgaaa atgcaccatc aggattggaa        60
     tttaagttac atccaattat ggaaaagaat tttggatata ttaaggattt agagatcagt       120
     aaagatgaga attataatct ttatataaat aaaaaaggaa agcgtaatgg tacaataatg       180
     attatggctc actctgatga gatttcctta gttattacag aagtgattga gggagggttt       240
     ttacgtttta aagctatagg tatggacgct aatatactat taggacaaga agtggctatt       300
     catggatgtg aagttataaa cggtgttata ggtggaattc caaagagcaa gactgatgac       360
     aacattttga aaaaagcagt agtaacatca gaccttttta tagatacagg atatcctaaa       420
     gaatatcttg aggaagttat taaaatagga gatagagcga ctttaattgg agaatataaa       480
     aacttactga gaaatacaat ctctagtaaa gcaatagatg atagagcagg tattttatcg       540
     atgcttatat gtgctcagga acttaaggaa catgagttag atgtggtttt tgtatgttca       600
     tgccaagaag aacttggaca taggggagcg aaaatggcat cgtataaagt gaaaccaaac       660
     cttgcaatag ctatagatgt aacctttgat aatggtgaat ttggagacag ggacagggaa       720
     aataagttag gcaatggtcc cattatttgt attggtccta ataatcaccc aaggatgata       780
     aagaaactta aggaagtagc aaggaaatat tatattcctt ttggagtgga agtagagcct       840
     gggaatacag gatctgatgc ttgggatatt caagtttcaa gaggaggtat tccaacagta       900
     ttagtatcaa taccaataaa atatatgcat acatccgtag aaacagcaaa tttgggggac       960
     ataaaaaaca caggaagatt agtagctaga ttcatagaag aaattaaact tctggatttg      1020
     gaggaattaa catgctttta g                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page