(data stored in ACNUC7421 zone)

EMBL: CP002160.PE7

CP002160.PE7         Location/Qualifiers
FT   CDS_pept        6781..9294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: cac:CAC0007 DNA
FT                   gyrase subunit A; PFAM: DNA gyrase/topoisomerase IV subunit
FT                   A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49798"
FT                   /db_xref="GOA:D9SML3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML3"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADL49798.1"
FT                   /translation="MNNNEGKTLPVDISNEMKKCYIDYAMSVIVGRALPDVRDGLKPVH
FT                   RRILYSMYELGITPDKPHRKCARIVGDVLGKYHPHGDSSVYDALVRLAQDFSMRYTLVD
FT                   GHGNFGSVDGDGAAAMRYTEARMDKMANEMVRDINKNTVDFIPNYDGDEQEPTVIPSRF
FT                   PNLLVNGSSGIAVGMATNIPPHNLTEVIDGVNLLIENPEATVLDLMTKIKGPDFPTAGI
FT                   IMGKSGIREAYETGRGKVVVRANATIEEDGGRHKIIVTEIPYQVNKAKLIENIADLVKD
FT                   KKIVGISDLRDESDRDGMRIVIELKRDANPNVILNQLYKHTKLQDSFGIIMLALVDNQP
FT                   KVLNLKEVLVHYLNFQKEVITRRTQFELEKAEARAHILEGLKIALDNIDEVISIIRSSK
FT                   STNEAKERLQERFALSEKQSTAIVEMRLRSLTGLERQKIEDELSELMALINKLKEILAN
FT                   EALILNIIRDELNEIKGRFGDERRTAIEASQNDINIEDLIQEHKVVVTLTRAGYIKRIA
FT                   ESTYSAQKRGGKGIQAATTKEDDIVENIFVTSTHDHILFFSNFGRVYTLKGYEIPEAGR
FT                   TAKGTNVINLLLLRPEEKIQAVITLSEFEKSQYLVFGTKKGIIKKTTLEDFSNIRKNGL
FT                   NAVGLREDDELISVRLSSGEDQIIMVTQNGYSIRFKEEDVRPMGRTATGVKGISLRDED
FT                   NVVSMEIVDESMDILVVSENGYGKRTPIGEYKCQNRGGMGIITYKVSEKTGKVVAATMV
FT                   NDEHEIMIINSADIVIRINSKEISTTGRSAMGVTLMRNNDETKVLAIAKVISDDEEIED
FT                   LQEHNEIQSLEQEAEVQEDTNNSEE"
     atgaacaaca atgaaggtaa aacattacct gttgatatta gtaatgaaat gaaaaaatgc        60
     tatatagatt atgcaatgag tgttatcgtt ggtcgtgcac ttccagatgt aagggatggt       120
     ttaaagcctg ttcatagaag aatactttat tcgatgtatg aactaggcat aacacctgat       180
     aagccacata gaaagtgtgc aagaatagtc ggagatgtac taggtaaata tcacccacat       240
     ggtgattcat cagtttatga tgcattagtt agattagctc aagatttctc aatgagatat       300
     actcttgtag atggccatgg aaattttggt tctgtcgatg gtgatggtgc agctgccatg       360
     agatatacag aagcaagaat ggataagatg gctaatgaaa tggtcagaga tataaacaag       420
     aacactgtag attttattcc taactatgat ggagatgaac aagaaccaac ggtaatacct       480
     tcaaggtttc ctaacctttt ggtaaatggt tcatctggaa tcgctgttgg tatggctact       540
     aatatacctc cgcataactt gacagaagtt atcgatggtg taaatttatt aattgaaaat       600
     cctgaagcta cagtactgga tcttatgact aaaattaaag gaccagactt tcctacagca       660
     ggaataatta tgggtaagtc tggaataaga gaagcttatg agactggaag aggtaaagtt       720
     gtagttagag caaatgcaac cattgaagaa gatggtggaa gacataaaat tatagttaca       780
     gaaatacctt atcaagtaaa taaagctaag ttgatagaaa acatagcaga ccttgtaaag       840
     gataaaaaga ttgttggaat ttcagacctt cgtgatgaat cagacagaga tggtatgaga       900
     atagtaatag aacttaaaag agatgcaaat ccaaatgtaa tattaaatca attatataag       960
     catacaaaac ttcaagatag ttttggtatt ataatgcttg ccttagttga caaccaacca      1020
     aaagttctaa atttaaagga ggttctagtt cattatctta acttccaaaa agaagttata      1080
     acaagaagaa ctcagtttga attagaaaaa gcagaagcta gagctcatat tttagaaggc      1140
     ttaaaaatag cattagataa tatcgatgag gttataagta taatacgaag ttcaaaatca      1200
     actaatgaag ccaaggaaag acttcaagaa agattcgcct tatctgaaaa acaatcaact      1260
     gctatagttg aaatgaggtt aagaagttta actggtttag aaagacaaaa gatagaagat      1320
     gaattaagtg aacttatggc cttaattaac aagttaaaag agattctggc aaatgaagct      1380
     ttaattctaa acatcataag ggatgaactt aatgaaatta agggaagatt cggtgatgaa      1440
     agaagaactg ctatagaagc gtcacaaaat gatattaata tagaggacct tatacaagag      1500
     cataaggttg ttgtgacatt aacgcgtgct ggatatataa agagaatagc agaaagtact      1560
     tattcagcac aaaaaagagg tgggaagggg atccaagctg ctaccaccaa ggaagatgat      1620
     atagtagaaa atatatttgt tacatcgaca catgatcata tattattctt ctctaatttt      1680
     ggaagagtat acacattaaa aggttatgag attccagaag caggtagaac tgctaaagga      1740
     actaatgtaa taaatttatt attgctaaga ccagaagaaa aaattcaagc tgttataact      1800
     ttaagtgagt ttgagaaatc tcaatactta gtatttggaa ctaagaaggg tatcattaag      1860
     aaaacaacat tagaggattt cagtaatatt agaaagaatg gtcttaatgc agtaggacta      1920
     agagaagatg atgagttgat ttctgttagg ctatctagtg gggaagatca gattataatg      1980
     gttactcaaa atggatattc tattagattc aaagaagaag atgtaagacc aatgggaaga      2040
     acagctacag gtgtaaaagg tatatcactt cgtgatgaag ataatgttgt aagtatggaa      2100
     attgtagatg aatctatgga tatattggtt gtaagtgaaa atggctatgg aaaaagaact      2160
     cctataggag agtataagtg ccaaaatagg ggtggaatgg gcataataac ttacaaggta      2220
     tcagagaaga ctggaaaagt tgtagcagct actatggtta atgatgagca tgaaatcatg      2280
     attataaata gtgctgatat agttattagg attaattcaa aagaaatatc tacaacaggc      2340
     agaagtgcaa tgggagttac cttaatgaga aataacgatg aaacaaaggt tcttgccata      2400
     gcaaaagtta ttagtgatga tgaagaaata gaagatttac aagagcataa tgagattcaa      2460
     tcgttagaac aagaagctga agtgcaagaa gatactaata atagtgaaga gtaa            2514
//

If you have problems or comments...

PBIL Back to PBIL home page