(data stored in ACNUC7421 zone)

EMBL: CP002160.PE73

CP002160.PE73        Location/Qualifiers
FT   CDS_pept        129365..130279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0075"
FT                   /product="1-phosphofructokinase"
FT                   /note="KEGG: cpr:CPR_0551 1-phosphofructokinase; TIGRFAM:
FT                   1-phosphofructokinase; PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49864"
FT                   /db_xref="GOA:D9SMS9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS9"
FT                   /inference="protein motif:TFAM:TIGR03168"
FT                   /protein_id="ADL49864.1"
FT                   /translation="MIYTVTLNPSIDYIVKVDDFSLGEVNRTEVDEKYPGGKGINVSRV
FT                   LKHLGVESKALGFVGGFTGYYIKESLKGFGVETDFIEVEEDTRINIKIKSNMETEINGA
FT                   GPKISEDKFNELKEKIAKLKDNDVLVLAGSVQSSLSKDTYVQLIKALKSQKIKVVVDTT
FT                   RELLLSTLTHKPFLIKPNKSELAELFNTKIDSLEEVIEYASKLREMGAENVIVSMAGDG
FT                   SLLICDQGVFRAKAPKGQVKNSVGAGDSLVAGFIEGYTKTKDIKEALVHGTASGSATAF
FT                   SMDLCTKEEFELILDKVEVNKLY"
     atgatatata cagttacatt aaacccatcg attgattata tcgtaaaggt tgatgatttt        60
     tctttgggtg aggtaaatag aactgaggtt gatgaaaaat atcctggtgg taaagggata       120
     aatgtttcaa gagtattgaa acatttaggg gttgaaagta aagccttagg ttttgttgga       180
     ggctttactg gatattacat taaggagtct ttaaaagggt ttggcgtaga gacggatttt       240
     attgaagtag aagaagacac tagaataaat attaagataa agtcaaatat ggagactgag       300
     attaatggag ctggccctaa aatttctgaa gataaattta atgaacttaa ggaaaagata       360
     gcaaaactaa aggataatga tgttcttgta ttagcaggaa gtgtacaaag ttcattgtca       420
     aaagacacat atgtgcagct tataaaagct ttaaaaagtc aaaaaataaa ggttgtagtt       480
     gatacaacta gagaattact tttaagtacc ttaacacaca agccatttct gataaaacct       540
     aataaaagtg aattagcaga actttttaat accaaaatag attctcttga agaagtaata       600
     gaatatgcta gtaaattaag agagatgggt gcagagaatg ttatagtttc aatggctgga       660
     gacggatctt tgttaatatg tgatcagggg gtatttaggg ctaaagcacc taaaggacaa       720
     gttaaaaatt ctgtgggagc aggtgattct ctagtagctg gtttcataga aggatacact       780
     aaaactaaag atattaagga agcgttggtt catggcacag cttcaggtag tgcaacagct       840
     ttttcaatgg atttatgtac taaagaagaa tttgaactaa ttttagataa ggtagaggtt       900
     aacaaattgt attaa                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page