(data stored in ACNUC7421 zone)

EMBL: CP002160.PE76

CP002160.PE76        Location/Qualifiers
FT   CDS_pept        134700..135791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0078"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="TIGRFAM: chorismate synthase; KEGG: cno:NT01CX_0623
FT                   chorismate synthase; PFAM: chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49867"
FT                   /db_xref="GOA:D9SMT2"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT2"
FT                   /inference="protein motif:TFAM:TIGR00033"
FT                   /protein_id="ADL49867.1"
FT                   /translation="MSSVWGNIMKVSLFGESQGDIIGVTIHGIPSGVKLDLEFIKKEMK
FT                   RRLSGNYNVATPRQEDDEFIITTGYFNGYTTGAPLTATIKNKDIKQADNDEFKDKMRPS
FT                   FGDYTEHLRYNGFNDYRGGGHHSGRLTAPLLFAGAVAKLILKEKNIVIGAHILKIADIF
FT                   DEVFDKVNVSEELLKSLPEKLFPVIKDDMGLIMQTEILKAKYQKDTIGGIVECAAINIP
FT                   GGVGNPFFDSMESVISHLLFSIPSIKAVEFGEGFNIANLRGSQANDQMYMEGDKVKTYT
FT                   NHSGGIVAGITNGMPIIFRVAVKPPPTIAKPQKTVDISTKENTTVDTVSAHDPSMIHRI
FT                   VPVIEGVTALAILDSILSGNNHI"
     atgagcagtg tttggggaaa cataatgaaa gtatctttat ttggtgagtc ccaaggagat        60
     attataggtg taacaatcca tggaatcccc agtggagtta aacttgatct tgagtttata       120
     aaaaaagaaa tgaaaagaag actctcagga aattacaacg tagcaacacc acgacaagaa       180
     gatgatgaat ttattattac aacgggatat tttaatggat atactacagg cgctccatta       240
     acagcaacaa taaaaaacaa agacatcaag caagctgaca acgatgaatt taaagataaa       300
     atgcgaccat cttttggcga ttatacagaa cacttaagat ataatggatt caatgattat       360
     agaggtggtg gacaccactc aggaagactt acagcaccat tattgtttgc tggcgctgta       420
     gctaagctga ttttgaagga aaaaaatata gtaataggtg ctcatatatt aaagattgca       480
     gatatatttg atgaagtctt tgataaggtt aatgtaagtg aggaactatt aaaatcattg       540
     cctgagaaat tgtttcctgt aattaaagat gatatgggat taataatgca gacagaaata       600
     ttaaaagcta agtatcaaaa agataccatc ggaggaattg tagagtgtgc tgctattaat       660
     attccaggtg gagtagggaa tccatttttt gattcaatgg aaagtgtgat ctcacatctt       720
     ttattttcta taccatcgat aaaagcagta gagtttggag aaggttttaa tattgctaat       780
     ttgagaggct cacaagcgaa tgatcaaatg tacatggaag gtgataaagt aaaaacttat       840
     accaaccata gtggcggaat agtagctggt ataacaaatg gaatgccaat aatatttaga       900
     gttgctgtta agccaccacc tacaatagct aagcctcaaa agactgtaga tataagcact       960
     aaggagaata ctactgtaga tacagtaagt gctcatgatc catcaatgat tcatagaata      1020
     gtgcctgtaa ttgaaggtgt tacagcctta gcaattttag attctatctt aagcggaaat      1080
     aatcatattt ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page