(data stored in ACNUC7421 zone)

EMBL: CP002160.PE81

CP002160.PE81        Location/Qualifiers
FT   CDS_pept        139690..141612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0083"
FT                   /product="putative serine protein kinase, PrkA"
FT                   /note="KEGG: cpr:CPR_1334 serine protein kinase; PFAM: PrkA
FT                   AAA domain protein; PrkA serine kinase; SMART: PrkA AAA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49872"
FT                   /db_xref="GOA:D9SMT7"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT7"
FT                   /inference="protein motif:PFAM:PF08298"
FT                   /protein_id="ADL49872.1"
FT                   /translation="MDFEELILHDREKRNKSKFEGSFLEYLELVRNKPEVAKLAHERMY
FT                   NLLMEKGFDVLKAEDNPRVKKIYGNDIIKRYNFFKDDFFGIDKVLIKLVNYFYSAAMKG
FT                   EEARQVLYLVGPVGAGKSSLVEALKKALETADPIYSLKGCPMHEEPLHLIPKHLRGEFE
FT                   EYLGVQIEGDLCPACRYRLLHEYDGQYEKFPVVETSFSIRSRKGVGVVPPVDPNNQDTS
FT                   ILTGSVDISKMDMYPEDDPRIFSLNGAFNVGNRGLVEFIEVFKNDVEYLHTIITATQEK
FT                   SIPSPGKGSMIYFDGVILAHSNEAEWEKFKSDHTNEAILDRIVKIEVPYCLELSEEIKI
FT                   YEKILKKSNFNAHIAPHSIEVAAMFAILSRLTPSAKVDPVTKLKIYNGEEIVEKGTTKR
FT                   IDIGELREEAGQKEGMKGISTRFIIKAIDNALSNSEHNCINPLSIMESMIKSVKEVDIA
FT                   EDEKKRLLGFIQDTIRKEYNKILEKEITKAFIHSFREQAESLFNNYLDNAEAFVNKNKL
FT                   KDRSTGEELVPDEKFMRNIEEQIGISEGSSKGFRNDVTSYMFYLVRNGGTIDYTSYEPL
FT                   KEAIEKKLMASVKDLSRIVTKSRVRDKEQDIKYNTMVEEMKSNGYCDHCCDVVLKYAAN
FT                   NLWKD"
     atggattttg aagaattaat tctacatgat agagaaaaga gaaataagag taaatttgaa        60
     ggaagctttt tagaatattt agaactagtg agaaacaaac cagaggtggc aaaacttgct       120
     catgaaagaa tgtacaattt actaatggaa aaaggatttg atgtattaaa agcagaggat       180
     aacccaagag ttaaaaaaat atatggaaat gacataatta aaagatacaa tttctttaag       240
     gatgattttt ttggtataga taaagtgctt ataaagcttg ttaattattt ttattctgct       300
     gcaatgaaag gtgaagaagc tagacaggta ttatatcttg ttgggccagt tggagcagga       360
     aaatcttctt tagtagaggc tctaaaaaaa gcgctagaga cagcggaccc tatttattca       420
     ttaaaaggat gtccgatgca tgaagaacca ctacatctca taccaaaaca tcttagaggt       480
     gagtttgagg aatacttagg agttcagata gaaggagatt tgtgtccagc ctgtagatat       540
     agattactgc atgaatatga tggacaatat gaaaagttcc cagttgttga aactagcttc       600
     tcaataagat ccagaaaagg tgtcggtgta gtaccaccag tagatcctaa taatcaggat       660
     acatcaatat taactggttc tgttgatatt tctaaaatgg atatgtaccc agaggatgat       720
     ccaagaattt tctctttaaa tggagcattc aatgtaggta acagaggttt agttgaattt       780
     atagaagtat tcaaaaatga tgttgaatat cttcatacta taattacagc aactcaggaa       840
     aaatcaatac catcaccagg caaaggctct atgatatatt ttgatggagt tatattggct       900
     cactccaatg aagctgaatg ggagaaattt aaatcagatc atactaatga agctatttta       960
     gatagaatag ttaaaataga ggttccatat tgtttagagc taagtgaaga aattaagata      1020
     tatgaaaaga tattaaaaaa gagcaacttc aatgctcata tagcaccaca tagtatagaa      1080
     gtagctgcga tgtttgctat attatcaaga ctcacaccat cagcaaaggt tgaccctgta      1140
     acaaagctta aaatatataa cggtgaagaa attgttgaaa agggaacaac aaagagaatt      1200
     gacataggtg agttaaggga agaagcggga cagaaagaag gcatgaaagg aatttcaaca      1260
     agatttatta tcaaagctat tgataatgcc ctttctaatt ctgagcacaa ctgtataaat      1320
     cctcttagca taatggagag tatgattaaa tctgttaaag aagttgacat tgcagaggat      1380
     gaaaagaaga gacttctagg atttatccaa gatacaataa gaaaagaata taataagatt      1440
     cttgaaaaag aaatcacaaa ggcatttatt catagcttta gagagcaagc agaaagctta      1500
     tttaacaact acttggataa tgcagaagct tttgttaata agaataaatt gaaagatcgt      1560
     tcaactggcg aagaactagt gccagacgaa aaatttatga gaaacatcga agagcaaatt      1620
     ggaatatctg aaggctcatc taaaggcttt agaaatgatg tgacatcata tatgttctat      1680
     ttggtaagaa atggtggaac tatagattat acttcctatg agcctttaaa ggaagctatt      1740
     gagaagaaac ttatggcttc tgtaaaggat ttatctagaa tcgtaaccaa atcaagggtt      1800
     agagataaag aacaggatat taagtataat actatggtgg aggaaatgaa gtctaatggt      1860
     tattgtgacc attgctgcga cgtagtcctt aaatatgcag ctaacaatct atggaaggat      1920
     tga                                                                    1923
//

If you have problems or comments...

PBIL Back to PBIL home page