(data stored in ACNUC7421 zone)

EMBL: CP002160.PE87

CP002160.PE87        Location/Qualifiers
FT   CDS_pept        complement(154943..155800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0089"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="TIGRFAM: 5,10-methylenetetrahydrofolate reductase;
FT                   KEGG: cbk:CLL_A2856 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49878"
FT                   /db_xref="GOA:D9SNK7"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNK7"
FT                   /inference="protein motif:TFAM:TIGR00676"
FT                   /protein_id="ADL49878.1"
FT                   /translation="MKIKDILDNRQSFSVELFPPKKTDSFDNIINTLDNLNGLDIDFVS
FT                   VTYGAGGSSRDNTVKLSKKIKSEYNLEVITHLTCINSKKDEIASLLDEMKENNLENILA
FT                   LRGDIPSEVIYDDYKYASDLIPEIKSLGDFCVGAACYPEKHPEAPSNVYDIKKLKQKTA
FT                   LGCDFLISQLFLDNTMFFNFQERLELADVNTKVLAGIMPVINKAQFERIIQLSGCNVPP
FT                   KFKKILEKYEHNPSALKDAGIAYAIDQIIDLMCHDVDGIHLYIMNKPENAKRILDNITG
FT                   LRNA"
     ttgaaaatta aagatatact agataataga caatctttct cggtggaact ttttccacct        60
     aaaaaaacag attctttcga taatataata aatactttgg ataacctaaa tggtttagat       120
     atagacttcg taagcgttac ttatggtgct ggcggaagtt ctagagataa tactgttaaa       180
     ttatcaaaga aaattaaaag tgaatataac ctagaagtaa taacacatct tacatgtatt       240
     aattctaaaa aagatgagat agcttctctt ctagatgaaa tgaaagagaa taatctagaa       300
     aatatattag cactaagagg cgatattcct agcgaagtta tatatgatga ctacaagtac       360
     gcttcagatt taatacctga aatcaagagc cttggcgatt tttgtgtagg cgctgcctgc       420
     tatcctgaaa aacatccaga agcaccttct aatgtttatg acataaagaa acttaaacaa       480
     aagacagctt taggttgcga ctttttaatc tctcaattgt ttttagataa tactatgttc       540
     tttaactttc aagaacgatt agagttagct gatgttaaca caaaagtatt agctggtata       600
     atgcctgtaa ttaataaagc tcagtttgaa cgtattattc aactttcagg ttgtaatgtg       660
     ccaccaaaat tcaaaaaaat acttgagaaa tatgaacata atccgtcagc tttaaaagat       720
     gctggtatag cttatgcaat tgatcaaatt atagatttga tgtgtcatga tgttgacggt       780
     attcatcttt atataatgaa taaacctgaa aatgctaaaa gaattctaga caatattacc       840
     ggattaagaa atgcctag                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page