(data stored in ACNUC7421 zone)

EMBL: CP002160.PE89

CP002160.PE89        Location/Qualifiers
FT   CDS_pept        163500..164330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0091"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   ecb:100061213 aldehyde dehydrogenase 18 family, member A1"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49880"
FT                   /db_xref="GOA:D9SNK9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNK9"
FT                   /inference="protein motif:PFAM:PF00696"
FT                   /protein_id="ADL49880.1"
FT                   /translation="MNFDCELVGKVGSMALIRKGEYDIDYNVFSRLGKELYPGCIWVSS
FT                   GAVEIGRIDYMKRNNLNEIENYDIEEVKSNYASQGQAILMENYRKFINPNFSVRQLLVE
FT                   HHHFNDVEKREFIRKLLLNSIKQNAIPIVNYNDSVSNEEIRKMELYNLRLNQDKVVECI
FT                   DNDETASAISVLVKSKYLLILTSEIGLLKDPRDTKTLIREVEGKDTYELIDHISELQQY
FT                   CIGASREGANGMKAKLEYLIEPIKQGTTVIIGHSKYGISDLIKGNVERTIFRVR"
     ttgaattttg attgtgaact tgttggcaag gttggttcaa tggcattaat tagaaaaggc        60
     gaatatgata tagactataa tgtttttagt agattaggga aggaacttta tccaggatgt       120
     atatgggtaa gttctggagc tgttgaaatt ggtcgtattg attatatgaa aagaaacaac       180
     ctaaatgaaa tcgaaaatta tgatattgaa gaagttaaat cgaattatgc ctcacaaggg       240
     caagcgattc tcatggaaaa ctatagaaag tttattaacc ccaatttttc agtaaggcag       300
     cttttagtgg aacaccatca ttttaatgat gtggaaaaaa gagagtttat aaggaagttg       360
     ctgcttaact caataaaaca aaatgcaata ccaatagtaa actataatga ttctgttagt       420
     aatgaagaaa taagaaaaat ggaactttat aacttaaggt taaatcaaga caaagttgtt       480
     gaatgtattg ataacgatga aactgcttca gcaatatcag tattagtaaa gtcaaaatat       540
     ttattgatat taacatcaga aataggtttg ttaaaggatc caagagatac taaaacatta       600
     attagggaag tagagggaaa agacacttat gagctaattg accacataag tgaacttcaa       660
     caatattgta ttggagcaag cagagaagga gcaaatggta tgaaggcaaa gcttgaatac       720
     ttaattgagc ctataaaaca aggtactacg gtaattattg gacattcaaa atatggtata       780
     tctgatttaa tcaaaggaaa tgtggaaaga acaatattcc gtgtaagata g                831
//

If you have problems or comments...

PBIL Back to PBIL home page