(data stored in ACNUC7421 zone)

EMBL: CP002160.PE9

CP002160.PE9         Location/Qualifiers
FT   CDS_pept        15828..16331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0009"
FT                   /product="3H domain-containing protein"
FT                   /note="PFAM: 3H domain-containing protein; KEGG:
FT                   cbf:CLI_0020 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49800"
FT                   /db_xref="GOA:D9SML5"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="InterPro:IPR035922"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML5"
FT                   /inference="protein motif:PFAM:PF02829"
FT                   /protein_id="ADL49800.1"
FT                   /translation="MSPDERRKFILNKLIDDKEVLKGQVLAEFLKVTRQIIVKDIAILK
FT                   AEGHNIISTPKGYMIQQENKDLKKVIAVFHDEKDIETELSIIVKYGGIIEDIRVEHAVY
FT                   GEITAMLMIKTIYEVQSFIQKLKDSKPLSALTGGVHLHLIRYKDEEMLQNILRELKEKN
FT                   LLLE"
     atgtcaccag atgagagaag aaaatttatt cttaataagt taatagatga taaagaagtt        60
     ttgaaaggac aggtattagc agagtttctt aaggttacta gacaaataat tgttaaagac       120
     atagctattt taaaagcaga aggacataat ataatttcaa ctccaaaagg ttatatgata       180
     caacaagaga ataaagattt gaaaaaggta atagctgttt ttcatgatga aaaagatatt       240
     gaaacagaac taagcatcat tgtaaaatat ggtggtataa tcgaggatat tagagttgaa       300
     catgctgttt atggtgaaat aacagctatg cttatgataa aaactattta tgaagtacaa       360
     agttttatac aaaaattgaa agattcaaag cctctttcag cgttgactgg aggcgtgcat       420
     ttgcatttaa ttcgatataa agatgaagaa atgcttcaaa atatccttag agaattaaaa       480
     gaaaaaaatc tattattaga ataa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page