(data stored in ACNUC7421 zone)

EMBL: CP002160.PE93

CP002160.PE93        Location/Qualifiers
FT   CDS_pept        168828..169328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0095"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbi:CLJ_B0084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49884"
FT                   /db_xref="GOA:D9SNL3"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNL3"
FT                   /inference="similar to AA sequence:KEGG:CLJ_B0084"
FT                   /protein_id="ADL49884.1"
FT                   /translation="MYNEMVTHKKLPMVIIWIVLLLSLIVAKEIIASYSSMESTIRIVL
FT                   EVFLLIIGSVGTCYQIRVCKIKYRYSVIANELIVKKIIGRKKKVQEIVKLEDIVFLGKA
FT                   NECRSLTNKFCHKYICLSCSNEKYCCIYNSGKKIKKFFFQPSGAFVEKLNHCVYLNCTT
FT                   KTV"
     atgtataatg agatggttac ccataaaaag ctgcccatgg taattatttg gatagttctt        60
     ttattatcat taatagttgc aaaagagatt atagcaagct actcatctat ggagagtaca       120
     atacgtatag ttttagaagt atttttactt attataggga gtgtggggac atgctatcaa       180
     ataagagtct gtaagataaa atacagatat tctgtaatag ctaatgaact cattgtaaag       240
     aaaataattg gacgaaagaa aaaggtacaa gaaattgtaa aacttgagga tatagttttt       300
     ttaggaaaag caaatgaatg cagaagttta acaaataaat tttgtcataa atatatatgt       360
     ttatcttgta gtaatgaaaa atattgttgt atatataatt ctggaaagaa gattaagaaa       420
     tttttctttc aaccaagcgg agcatttgtg gaaaaattga accattgtgt ttatcttaat       480
     tgcactacaa aaacagtata g                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page