(data stored in ACNUC7421 zone)

EMBL: CP002160.PE96

CP002160.PE96        Location/Qualifiers
FT   CDS_pept        171194..172636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0098"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG: cac:CAC0297
FT                   lysine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49887"
FT                   /db_xref="GOA:D9SNL6"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNL6"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ADL49887.1"
FT                   /translation="MSKSPIVEEVLSYYEEDNILFCMPGHKKGFGFTRDSLGEKLFNCF
FT                   IQSDITEVEPLDNYHNPQGIIKEAENLLTKFYGSYKSKFLVNGSTSGNLAMIFSAFEEN
FT                   DKVIVERNCHRSVLNAIILRKLNPIYIENSFIESLGTPLSINEEDFFHVLNNNPDAKGI
FT                   ILTYPNYYGVCCDLKKIIKICHERNMVVLVDSAHGAHFGIHEDIPQSAVKLGADVVVTS
FT                   AHKTLPALTQGSYIHINNKMLEDKCSFYISAFTTTSPSYLIMCSLDYSRYYLEAYGNED
FT                   YGMLLGLCREYREKISEIPKFSILERKHISGKAYDIDETRFVITLDNGYSGHKLLEYLR
FT                   TNKIQGEMSDDRSVVLLFSTFTRREEFESLYQVIKACDMLELQDEDSIKHISMPKGQQV
FT                   ICPYEAIELKGEYIDYKKCENKVALKAIVPYPPGVPLVAIGERITKAIIEVIEKALKNK
FT                   QQILGVTDNKVYVADLHRFPQP"
     ttgtcaaaat cgcctatagt cgaagaggtt ttaagttatt atgaagagga taacattcta        60
     ttttgtatgc caggacataa gaaaggcttt ggatttacaa gagattccct tggagaaaag       120
     ctttttaatt gctttataca aagtgatata acagaggttg agcctttaga taattatcat       180
     aatccacaag ggataataaa ggaagcggaa aaccttttaa caaagtttta tggaagttat       240
     aaaagtaagt ttcttgttaa tgggagtacc agtggcaatc ttgcaatgat tttttcggcc       300
     ttcgaagaga atgataaagt tatagttgaa agaaactgcc atcgttctgt actaaatgca       360
     atcatcctaa gaaagttaaa tcctatatat atagagaata gttttataga gtcattaggt       420
     actcctctat ctataaatga agaggatttt tttcatgttt taaataataa tcctgatgct       480
     aagggaatta tattaaccta tccaaactat tatggggtat gctgtgattt gaagaagata       540
     ataaaaattt gtcatgaaag aaatatggta gttcttgtag atagtgctca tggagctcat       600
     tttggtatcc atgaggatat accacagagt gcagttaaat taggagcaga cgtagttgta       660
     actagtgcgc ataagacttt gccagcattg acccagggat catatataca tataaataat       720
     aaaatgttag aagataaatg tagtttttat ataagtgcgt ttactactac aagcccatcg       780
     tatttaataa tgtgttcttt agactatagt aggtattact tagaagctta tggaaatgaa       840
     gactatggaa tgcttttagg attgtgtaga gaatatagag aaaaaataag tgaaattcct       900
     aagttcagta ttctggagag gaaacatatt tcagggaaag cctatgatat agatgaaact       960
     aggtttgtta taacgctaga taatggttat agtgggcata aacttcttga atatctaaga      1020
     acaaataaga tacagggaga aatgagtgat gacagaagtg ttgtgctttt attttcaact      1080
     tttaccagaa gagaagaatt cgaaagttta tatcaggtta tcaaagcttg cgatatgtta      1140
     gaacttcaag atgaagattc tattaaacat atatctatgc caaaagggca acaagtaatt      1200
     tgtccttatg aagctattga acttaaaggg gaatatatag attataagaa atgtgaaaat      1260
     aaggttgcgt taaaagctat agtaccgtat ccaccaggtg tgccgctagt tgccattggt      1320
     gagaggatta caaaggcaat aatagaagta atagaaaagg ccttgaaaaa taagcaacaa      1380
     attttaggtg ttacggataa caaggtatat gtagcagatt tgcataggtt tccacagcca      1440
     taa                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page