(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE102

CP002209.PE102       Location/Qualifiers
FT   CDS_pept        125667..126197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0102"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spl:Spea_3907 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74316"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW16"
FT                   /protein_id="ADN74316.1"
FT                   /translation="MKRSIAAVLLSTALLGGCASLTSSGTMLDLAGKTNQEATDALVTA
FT                   LTDKQYKVQRVSGQSLMVEYDNSHFMMQPKLTEDGLDRIVITKYYVLHPDLAQTPELLL
FT                   LIGQLNQRMDFAKFVLIEEGRGVEVRGAATFVDTISVEELTRFMDWTDAGLRALREAFP
FT                   QATPAAKEVRFGA"
     atgaaacgat ccattgccgc tgtgctgctc tccaccgcac tgctgggcgg ttgtgcttcc        60
     ctgacctcgt ccggcaccat gctggacctg gcgggtaaga ccaaccagga agccactgac       120
     gcgctggtga cggcgttgac cgacaagcag tacaaggtgc agcgggtcag tggtcagagc       180
     ctgatggtgg agtacgacaa cagccacttt atgatgcagc cgaagctgac tgaagatggc       240
     ctcgaccgca tcgtcatcac caagtattac gtgctgcacc ccgacctggc gcagaccccg       300
     gagctgctgc tgttgatcgg ccagctgaac cagcgcatgg actttgccaa gttcgtgttg       360
     atcgaagagg gccgcggggt ggaagtgcgg ggtgccgcca cctttgtcga caccatcagc       420
     gtcgaggaac tgacccgctt tatggattgg accgacgccg gtctgcgggc gctgcgtgaa       480
     gccttccctc aggccacgcc ggccgctaaa gaggtgcgtt tcggcgcctg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page