(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE104

CP002209.PE104       Location/Qualifiers
FT   CDS_pept        complement(126713..127576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0104"
FT                   /product="response regulator receiver modulated CheW
FT                   protein"
FT                   /note="COGs: COG0835 Chemotaxis signal transduction
FT                   protein; InterPro IPR001789: IPR002545; KEGG: saz:Sama_2201
FT                   chemotaxis protein CheV; PFAM: CheW domain protein;
FT                   response regulator receiver; SMART: CheW domain protein;
FT                   response regulator receiver; SPTR: A2V174 Response
FT                   regulator receiver modulated CheW protein; PFAM: CheW-like
FT                   domain; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74318"
FT                   /db_xref="GOA:E1SW18"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW18"
FT                   /protein_id="ADN74318.1"
FT                   /translation="MDQGSAARQELLVFSLAHNQLFAFSTLKVREIVTLSQFNRLPGSH
FT                   PAIAGTLTLRGETLAVVDLNRAIGLTGEPPQSVVVCEIQGTLYGLLVGTIEAIHAVEIA
FT                   AIAALPKGLGQRTFSSAVFRDEQNRLVQLLDLERIVGEIHPGDTTIPALDPASLARIRA
FT                   QKILICDDSRFARKQMARALEAHQIDYLSAPNGRAALSVLKREADAGTPVQILVSDIEM
FT                   PELDGYQLALSVRADDHLRPAYVILHSSLNPVICERITQAAGANEGLTKFDPHALLAAI
FT                   GRGAGA"
     atggatcaag gctctgccgc ccgtcaggaa ctgttggtgt tctccctggc ccacaaccag        60
     ctgttcgcct tctccactct gaaggtgcgc gaaatcgtca ccctcagtca gtttaaccgc       120
     ctgcccggca gccatccggc catcgccggc accctgaccc tgcgcggtga aaccctggca       180
     gtggtcgacc tgaaccgcgc catcggcctg accggggagc cgccgcaaag cgtggtggtc       240
     tgcgagattc agggcacact ctatggcttg ctggtgggca ccattgaggc gattcatgcg       300
     gtggaaattg ccgccatcgc tgcactgccc aaggggctgg gccaacgcac cttcagcagc       360
     gccgtattcc gggatgagca gaaccgcctg gttcaactgc tggacctgga gcgcattgtc       420
     ggcgagatcc atcccggtga caccaccatc cccgcactcg acccggccag cctggcccgc       480
     attcgcgccc agaaaatcct gatctgcgac gactcccgtt tcgcccgcaa gcagatggcc       540
     cgcgcgctgg aggcgcatca aatcgattat ctcagcgccc ccaatggccg ggcggcactg       600
     agcgtgctca agcgcgaggc cgacgccggc acaccggtgc agatcctggt ttcagacatt       660
     gagatgccgg aactggatgg ctaccaactg gcgctgtcgg tgcgcgccga tgaccacctg       720
     cgcccggctt acgtgatcct gcacagttcg ctgaatccgg tgatctgcga gcgcatcacc       780
     caggcggcgg gcgccaacga ggggttaacc aagttcgacc cgcacgccct gctggccgcc       840
     atcggccgcg gtgccggcgc ctga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page