(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE107

CP002209.PE107       Location/Qualifiers
FT   CDS_pept        complement(129114..131210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0107"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="COGs: COG1200 RecG-like helicase; InterPro
FT                   IPR001650: IPR011545: IPR004365: IPR014001: IPR 014021:
FT                   IPR019793: IPR004609; KEGG: vpa:VP0157 ATP-dependent DNA
FT                   helicase RecG; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; SMART: DEAD-like helicase ; helicase
FT                   domain protein; SPTR: A2PTP6 ATP-dependent DNA helicase
FT                   RecG; TIGRFAM: ATP-dependent DNA helicase RecG; PFAM:
FT                   Helicase conserved C-terminal domain; OB-fold nucleic acid
FT                   binding domain; DEAD/DEAH box helicase; TIGRFAM:
FT                   ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74321"
FT                   /db_xref="GOA:E1SW21"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW21"
FT                   /protein_id="ADN74321.1"
FT                   /translation="MTTSTPASVDKLNTLPVTTLKGVGDKLAEKLLRLGVRSVGDLLLH
FT                   LPLRYEDRTRIWPVAALTPGQNATVEGEVLSANVSYGRRRRMTVQLADGSGTISLHFFN
FT                   FALAQKDSFVVGARVRAFGEARAGMRHIEMVHPEYHVLGEHTHPLLEESLTPVYPTTEG
FT                   LKQAILRKLTDEALTLLRHHPLPELLPEGLYPHQLPLSDALHFIHRPPPDASLTQLESG
FT                   EHPAQQRLVMEELLAQNLSMLKLRADSGSHKALPLQPDTNLLQRFLAALPFQPTGAQQR
FT                   VVNEIAADLNQSEPMMRLVQGDVGSGKTLVAALAALHAISQGYQVALMAPTELLAEQHA
FT                   QAFANWFEPLGLPVAWLAGKLKGKAREAALERIASGEARMVVGTHAIFQSQVAFHHLAL
FT                   VIVDEQHRFGVHQRLTLREKGLKDGCYPHQLIMTATPIPRTLAMTAYADLDVSVIDELP
FT                   PGRTPITTVAIPDSRRDDVVERVRQACSNGRQAYWVCTLIEESEVLQCQAAEDTATELA
FT                   ERLPELNIGLVHGRMKADEKQQVMNAFKANELHLLVATTVIEVGVDVPNASLMIIENPE
FT                   RLGLAQLHQLRGRVGRGAVASHCVLLFHPPLSKTAQSRLGVLRESNDGFVIAQRDLEIR
FT                   GPGEVLGTRQTGLADLKIADLVRDAALIPQVQRLAQHLMDRYPSRVPAIIDRWLGGREI
FT                   YSQA"
     gtgaccacat ccacaccggc ttcggtggac aaactcaaca ccctgcccgt caccaccctc        60
     aagggggtgg gtgacaagct ggcggagaaa ctgctccgcc tgggggttcg cagtgtcggc       120
     gacctgcttc tgcacctgcc gctgcgttac gaagaccgta cccgcatctg gcccgtcgcc       180
     gccctgacgc cgggccagaa tgccactgtc gagggcgaag tcctctccgc caacgtcagt       240
     tatggcagac gccgccgcat gaccgtgcag ctggccgacg gcagcggcac catcagtctc       300
     cacttcttca actttgctct ggcccagaag gacagcttcg tggtcggcgc ccgggtgcgc       360
     gcctttggcg aagcccgcgc gggcatgcgt catattgaga tggtgcaccc ggagtaccat       420
     gttctgggcg aacataccca ccctctgctg gaggagagcc tgaccccggt ttatcccacc       480
     accgagggat tgaagcaggc gattctgcgc aaattgaccg acgaagccct gactctgctg       540
     cgtcatcacc cgctgccgga attgctgccg gaggggctct atccacatca gctgcccctg       600
     tcggatgccc tgcactttat ccaccgccca ccgccggacg ccagcctgac ccaactggag       660
     tccggggagc acccggccca acagagactg gtgatggagg agctgctggc ccagaacctg       720
     tcgatgctga aactgcgggc ggactccggc agccataagg ccctgcctct gcaaccggac       780
     accaacctgc tgcagcgctt cctcgccgcc ctgccattcc agcccaccgg ggcccagcag       840
     cgagtggtca acgagattgc cgccgacctg aaccagagtg aacccatgat gcgactggtt       900
     cagggcgatg tgggctctgg caagactctg gtggccgctc tggccgccct gcacgccatc       960
     tcccagggct atcaggtggc gctgatggcc cccaccgagc tgctggccga gcagcacgcc      1020
     caggccttcg ccaactggtt tgagcccctg ggcctgccgg tggcctggct ggccggaaaa      1080
     ctgaagggta aagcccggga agccgcactg gagcgcatcg ccagtggcga agcccgtatg      1140
     gtggtgggca cccacgccat cttccagagt caggtggcgt tccaccacct cgcgctggtg      1200
     attgtcgatg agcaacaccg ctttggcgtg caccagcgcc tgaccctgcg tgagaagggg      1260
     ctgaaggacg gctgttaccc gcaccagctg atcatgactg ccaccccgat cccccgcacc      1320
     ctggcgatga ccgcctacgc cgatctcgat gtttcggtga tcgacgagct gccgcccggc      1380
     cggaccccca tcaccacggt ggcgatcccg gacagtcgcc gcgacgacgt ggtcgaacgg      1440
     gtgcgacagg cgtgcagcaa tggccgccag gcgtattggg tttgtactct gattgaagag      1500
     tccgaagtcc tgcagtgcca ggccgccgaa gacactgcca ccgagttggc cgagcggtta      1560
     ccggagctga acatcggcct ggtacacggc cgcatgaagg cggacgaaaa gcagcaggtg      1620
     atgaacgcct tcaaagccaa tgaactgcac ctgctggtgg ccaccacggt gatcgaggtg      1680
     ggggtggatg tgcccaatgc cagcctgatg atcatcgaaa acccggagcg cctggggctg      1740
     gcccagctgc atcagcttcg gggccgggtg ggccggggcg ccgtcgccag ccactgtgtg      1800
     ctgctgttcc atccaccgct ctccaaaacc gcccagtccc gcctgggggt gctgcgggag      1860
     agcaatgacg gttttgttat cgcccagcgc gacctcgaga tccgcggccc cggcgaggtg      1920
     cttggcaccc gtcagaccgg cctggcagac ctcaagatcg ccgacctggt gcgcgatgcc      1980
     gcgctgatcc cacaggttca gcgattggcc cagcacctga tggaccgcta cccttcccgg      2040
     gtgcccgcca tcatcgatcg ttggctcggt ggacgagaaa tttacagtca ggcctga         2097
//

If you have problems or comments...

PBIL Back to PBIL home page