(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE108

CP002209.PE108       Location/Qualifiers
FT   CDS_pept        complement(131279..132925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0108"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG1022 Long-chain acyl-CoA synthetase
FT                   (AMP-forming); InterPro IPR020459: IPR000873; KEGG:
FT                   shm:Shewmr7_0326 AMP-dependent synthetase and ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; SPTR: A2UYT5
FT                   AMP-dependent synthetase and ligase; PFAM: AMP-binding
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74322"
FT                   /db_xref="GOA:E1SW22"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW22"
FT                   /protein_id="ADN74322.1"
FT                   /translation="MTLQTPLQMLDHWCAVQGDTVFLRQPRERQLHDLTWAQTREAAYR
FT                   LAGALRQLGLKRGDKVAILSKNCAQWFITDLALQAGGFISIPIYPTANADTIRYVLKHS
FT                   EAKAIFIGKLDNPELQADAISQDLLRFDMSFPTLPVQYQWHQLLEMSEPLDDARPELDD
FT                   IMTIIYTSGSTGNPKGAVETYRAYSWAGTAVSNHLGATAQDRVISYLPLAHITERVYIE
FT                   GTAFYSGGTVYFVEALDTFVDDVKVAQPTFFLSVPRLWTLFQKNIIDKVGASKLDLLLK
FT                   LPIISALVARKIRTQLGLNAAKVLGCGSAPVSPALLHWYRKIGMDITEAWGMTENGAYA
FT                   TLNFPYRPDKVGTVGKPGTECEVKIGDNQELLFKSPGLFTEYYKNPEATAEAFTEDGFF
FT                   RTGDQATIDDEQFVTITGRVKDNFKTAKGKFVAPVPLERKLAQNNHIELVCVIGSGLPY
FT                   PVALVQLSEGASLMPRDEVRQSLAETADMVSGQMESHATLGGVLVVAEPWDVENEVLTP
FT                   TLKIKRHVLEQRFSDRVAGLKGNKVMWEAEL"
     atgaccttac aaacgcctct tcagatgttg gatcactggt gcgcggtaca gggagatacc        60
     gtgttcctcc gccaaccccg ggaacgtcag ctgcatgacc tcacctgggc ccagacccgt       120
     gaagccgcct accgactggc tggtgcattg cgccagttgg gactgaaacg gggcgataag       180
     gtcgccatcc tctcaaagaa ctgcgcccaa tggtttatca ccgatctggc gctgcaggcc       240
     gggggcttta tcagcatccc gatctacccc accgccaacg ccgataccat tcgctacgtg       300
     ctcaagcact ccgaagccaa ggcgatcttt atcggcaaac tggacaaccc tgagctgcag       360
     gccgatgcca tcagccagga cctgctgcgc tttgacatga gcttcccgac cctgccggtg       420
     cagtaccagt ggcatcagct gctggagatg agtgagccgc tggacgatgc ccgtccggag       480
     ctggatgaca tcatgaccat catctacacc tccggcagca ccggtaaccc caaaggggcc       540
     gtcgaaacct accgcgcgta ctcctgggct ggcactgccg tgtccaacca cctcggcgcc       600
     acggcgcagg accgggtcat ctcctacctg cctctggccc acatcaccga gcgcgtctac       660
     atcgaaggca ccgccttcta cagcggcggc accgtctact ttgtcgaagc cctggacacc       720
     tttgtcgacg acgtcaaagt ggcccagccc actttcttcc tgtcggtacc gcgactctgg       780
     accctgttcc agaagaacat cattgataag gttggcgcgt ccaagctcga cctgctgctc       840
     aaactgccga tcatcagcgc cctggtggcc cgcaagatcc gcacccagct gggcctcaac       900
     gcagccaagg tgctgggctg tggttccgcc ccggtatccc ccgcgctgct gcactggtat       960
     cgcaaaatcg gcatggacat caccgaagcc tggggcatga ccgagaacgg cgcctacgcc      1020
     accctcaact tcccctaccg ccccgataag gtcggcactg tgggcaagcc cggtactgag      1080
     tgcgaagtga agattggcga caatcaggag ttgctgttca agagccccgg cctgtttacc      1140
     gagtactaca aaaacccgga agccaccgcc gaagccttta ccgaagacgg cttcttccgc      1200
     accggcgacc aggccaccat cgatgacgag cagttcgtca ccatcaccgg ccgggtcaaa      1260
     gacaacttca agaccgccaa gggtaagttt gtggcgccgg tgccactgga gcgcaagctg      1320
     gcccagaaca accacatcga gctggtgtgc gtgatcggct ccggcctgcc ctacccggtg      1380
     gcgctggtgc agttgtccga aggcgccagc ctgatgcccc gtgacgaggt gcgccagtcg      1440
     ctggcggaga ccgccgacat ggtctccggc cagatggaga gccacgcgac cctgggtggc      1500
     gttctggtgg tcgctgagcc ctgggatgtg gagaacgaag tgctgacccc gaccctgaag      1560
     atcaaacgcc atgttctgga gcagcgcttc agtgatcgcg tcgccggtct taagggcaat      1620
     aaagtgatgt gggaagccga actctaa                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page