(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE11

CP002209.PE11        Location/Qualifiers
FT   CDS_pept        complement(15214..16377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0011"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR002155: IPR001412: IPR012805; KEGG: shn:Shewana3_0023
FT                   3-ketoacyl-CoA thiolase; PFAM: Thiolase; PRIAM: Acetyl-CoA
FT                   C-acyltransferase; SPTR: Q0I0T4 3-ketoacyl-CoA thiolase;
FT                   TIGRFAM: acetyl-CoA C-acyltransferase FadA; acetyl-CoA
FT                   acetyltransferase; PFAM: Thiolase, C-terminal domain;
FT                   Thiolase, N-terminal domain; TIGRFAM: acetyl-CoA
FT                   acetyltransferases; fatty oxidation complex, beta subunit
FT                   FadA"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74225"
FT                   /db_xref="GOA:E1SUM0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM0"
FT                   /protein_id="ADN74225.1"
FT                   /translation="MNQAVIVDCIRTPMGRSKGGVFRNVRAETLSAHLMSQLLIRNPAL
FT                   DPNELEDVIWGCVQQTLEQGFNVARNASLLAGLPKSVGAVTVNRLCGSSMQALHDATRA
FT                   IAVGDGDAFIIGGVEHMGHVPMNHGVDFHPGLAKSVAKAAGMMGLTAEMLGKMHGITRA
FT                   QQDAFGARSHQRAHAATLEGRFDNEIVAIEGHDADGSLIQVRHDEVIRPETTVESLGAL
FT                   RPVFDPVNGTVTAGTSSALSDGAAAMLVMSEAKAKALGLPIRARIKSMAIAGCDPSIMG
FT                   YGPVPATQKALKRAGLTIQDIDLVELNEAFAAQSLPCVKDLGLMDQVDDKVNLNGGAIA
FT                   LGHPLGCSGARISTTLLNLMEHKDATLGLATMCIGLGQGIATVFERV"
     atgaaccagg ctgttattgt cgattgcatc cgtaccccga tgggccgttc caagggcggg        60
     gtatttcgca acgtacgagc ggagaccctt tccgctcacc tgatgagcca gctgctgatc       120
     cgcaacccgg cgctggaccc gaacgaactg gaagacgtga tctggggctg tgttcagcag       180
     acgctggagc agggcttcaa cgttgcccgt aacgcctctc tgctggcggg cctgcccaaa       240
     tcggttggcg cagtgaccgt gaaccggttg tgcggctcct ccatgcaggc actgcatgac       300
     gccacccgcg ccattgccgt gggtgatggc gacgccttta tcatcggcgg tgtcgagcac       360
     atgggtcatg tgccgatgaa ccacggtgtg gacttccacc cgggactggc caagtccgtg       420
     gccaaggccg ccggcatgat gggcctgacc gcagagatgc tgggtaagat gcacggcatc       480
     acccgtgccc agcaggacgc ctttggtgcc cgctctcacc agcgtgccca cgccgccact       540
     ctggaaggcc gctttgacaa cgagatcgtc gccattgaag gtcacgacgc cgacggcagc       600
     ctgatccagg tgcgccatga cgaggtgatt cgtccggaga ccaccgtcga gagcctcggt       660
     gcactgcgcc cggtgttcga cccggtcaac ggcaccgtga ccgctggcac ctcctcagcc       720
     ttgtctgacg gcgccgccgc catgctggtg atgagcgaag ccaaggccaa agcgctgggg       780
     ctgcctatcc gtgcccgcat caagtcgatg gccatcgcag gctgcgatcc ctccatcatg       840
     ggttacggtc cggtaccggc gacccagaag gcgctgaaac gtgccggcct gaccatccag       900
     gacatcgacc tggtggagct gaacgaagcg ttcgcggccc agtccctgcc ctgcgtgaaa       960
     gacttgggcc tgatggatca ggtggacgac aaggtgaacc tgaatggtgg cgccatcgcc      1020
     ctggggcacc cgctgggttg ttccggcgcg cgcatctcca ccaccctgct gaacctgatg      1080
     gagcacaagg acgccaccct gggtctggcc accatgtgca tcggtttggg tcagggcatc      1140
     gccacggtgt ttgagcgggt ataa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page