(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE110

CP002209.PE110       Location/Qualifiers
FT   CDS_pept        complement(133912..136017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0110"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /EC_number="3.1.7.2"
FT                   /note="COGs: COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase; InterPro IPR002912:
FT                   IPR004095: IPR006674: IPR007685: IPR 003607: IPR004811;
FT                   KEGG: swp:swp_0319 bifunctional (p)ppGpp synthetase
FT                   II/guanosine-3',5'-bis pyrophosphate
FT                   3'-pyrophosphohydrolase; PFAM: RelA/SpoT domain protein;
FT                   TGS domain protein; amino acid-binding ACT domain protein;
FT                   metal-dependent phosphohydrolase HD sub domain; PRIAM: GTP
FT                   diphosphokinase; SMART: metal-dependent phosphohydrolase HD
FT                   region; SPTR: A2UYT3 (P)ppGpp synthetase I, SpoT/RelA;
FT                   TIGRFAM: RelA/SpoT family protein; PFAM: HD domain; Region
FT                   found in RelA / SpoT proteins; TGS domain; TIGRFAM:
FT                   (p)ppGpp synthetase, RelA/SpoT family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74324"
FT                   /db_xref="GOA:E1SW24"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW24"
FT                   /protein_id="ADN74324.1"
FT                   /translation="MYLFEGLKELAASYLEPEQVEQLTQAYITARDAHDGQLRSSGDPY
FT                   ITHPVAVSRILAEMRLDHETLMAALLHDVIEDTELTQEDLAELFGAQVAELVEGVSKLD
FT                   KLKFRDRKEAQAENFRKMVMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIFAPLANRLGIHNIKNELEDLGFRALYPMRYRVLKEVVQAARGNRKELMQSIEAEIAG
FT                   RLEESGIPATVQGREKNLFSIYNKMVNKELQFQEVMDIYAFRITVANIDTCYRVLGAMH
FT                   TLYKPRPNRFKDYIAIPKANGYQSLHTSLFGPHGVPVEVQIRTEDMDQMADKGVAAHWL
FT                   YKNKGEAEATTTQVRARKWMQSLLELQQSAGNSFEFIESVKSDLFPDEIYVFTPTGKIL
FT                   ELPLGATAVDFAFAVHTDIGNSCVGARVNRHAYPLSMPLSSGQTVEIITAPGARPNAAW
FT                   LNFVVTAKARTKIRQVLKNLEQTESIALGKRLLNHALGELNLSDIPPAQLEQVISESRH
FT                   DSLDDMLAAIGLGDLMSLVVAQRLRGESASQANNPDSKLAIKGAEGMLVSFAKCCRPIP
FT                   GDDVVAHVSPGKGLVVHIDSCRNIRRNLEQEADKFLPVEWTDEPGAEYVTGLRIEIVNH
FT                   QGALAKLTSIIAGADANIHNLNTDEKDGRIYVINLTLTVQNRVHLANVLRKIRVMPEVL
FT                   KAARARS"
     ttgtacctgt ttgaaggcct gaaggaactg gctgccagct acctggaacc cgagcaggtt        60
     gaacagctca cacaagccta tatcacggcg cgtgatgccc acgacgggca gctgagatcc       120
     agcggcgacc cctatattac ccacccggtt gcggtttccc gcatcctcgc cgagatgcgt       180
     cttgatcacg agacgctgat ggctgccctc ctccacgatg ttatcgaaga cactgaactg       240
     acccaggaag acctggcaga gctgtttggt gcccaggtgg cagagctggt tgagggggtt       300
     tccaagctcg acaagctgaa attccgcgat cgcaaagaag cccaggcgga gaacttccgc       360
     aagatggtga tggcgatggt gcaggatatt cgcgtcatcc tgatcaagct tgccgaccgc       420
     actcacaaca tgcgtaccct ggggtcgctg cgtcccgaca aacgtcgccg catcgcccgg       480
     gagaccctcg aaatctttgc ccccctggcc aatcgtcttg gtatccacaa catcaagaac       540
     gagctggaag atcttggctt ccgcgccctc tacccgatgc gataccgggt gctcaaagag       600
     gtggtgcagg ctgcccgggg gaaccgcaaa gagttgatgc agagcatcga agcggagatc       660
     gccggtcgcc tcgaagagag cggcatcccc gccaccgtac agggccgtga gaaaaacctg       720
     ttctccatct acaacaagat ggtcaacaag gagctgcagt tccaggaggt gatggacatc       780
     tacgccttcc ggatcactgt cgccaacatc gacacctgtt accgggtgct cggtgccatg       840
     cacaccctgt acaagccgcg ccccaaccgc ttcaaagact acatcgccat ccccaaggcc       900
     aacggttacc agagcctgca tacctccctg ttcggccccc atggagtgcc ggttgaggtg       960
     cagatccgaa ccgaagatat ggaccagatg gcggacaaag gcgtggccgc ccactggctg      1020
     tacaagaaca agggcgaagc ggaagccacc accactcagg tgcgggcccg caagtggatg      1080
     cagagcctgc tggagctgca acaaagcgcc ggcaactcgt tcgaattcat tgaaagcgtg      1140
     aagtccgatc tgttcccgga cgagatctac gtctttaccc ccaccggcaa gatcctggaa      1200
     ctgcccctgg gcgccaccgc ggtggacttc gccttcgcag tacacaccga catcggcaac      1260
     agctgcgtcg gcgcgcgggt caaccgccac gcctacccgc tgagcatgcc gctgtcctcg      1320
     ggccagaccg tcgagatcat caccgccccc ggtgcgcgtc cgaacgccgc ctggctcaat      1380
     tttgtggtga ccgccaaagc ccggaccaag atccgccagg tgctgaaaaa cctggaacag      1440
     accgaatcca tcgccctggg caagcgtctg ctgaaccacg cccttggcga actgaacctg      1500
     agcgacatcc cacccgccca gctggaacag gtgatcagcg aatcccgcca cgacagtctg      1560
     gacgatatgc tggccgccat cggcctgggt gacctgatga gcctggtggt ggcacaacgc      1620
     ctgcgtggcg aaagtgccag ccaagccaac aatccggaca gcaagctggc gatcaagggt      1680
     gccgagggga tgctggtctc ctttgccaag tgctgccgcc ccattcccgg cgacgacgtg      1740
     gtggcccacg tcagccccgg caagggcctg gtggtgcaca tcgacagctg ccgcaacatc      1800
     cgccgcaacc tggagcagga agccgataag ttcctgccgg tggaatggac cgatgagcct      1860
     ggcgccgagt acgtcaccgg cctgcgcatc gagatcgtca accaccaggg tgcgctggcc      1920
     aagctcacct ccatcattgc cggtgccgac gccaacatcc acaatctcaa caccgatgag      1980
     aaggatgggc gcatctacgt catcaacctg accctgacgg tacagaaccg ggtgcacctg      2040
     gccaacgtac tgcgcaaaat ccgggtgatg ccggaagtgt tgaaggccgc ccgcgcacgc      2100
     agctga                                                                 2106
//

If you have problems or comments...

PBIL Back to PBIL home page