(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE111

CP002209.PE111       Location/Qualifiers
FT   CDS_pept        complement(136033..136311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0111"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /note="InterPro IPR006110: IPR003716; KEGG: saz:Sama_0265
FT                   DNA-directed RNA polymerase subunit omega; PFAM: RNA
FT                   polymerase Rpb6; SPTR: A1S270 DNA-directed RNA polymerase
FT                   subunit omega; TIGRFAM: DNA-directed RNA polymerase, omega
FT                   subunit; PFAM: RNA polymerase Rpb6; TIGRFAM: DNA-directed
FT                   RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74325"
FT                   /db_xref="GOA:E1SW25"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW25"
FT                   /protein_id="ADN74325.1"
FT                   /translation="MARVTVEDAVDKIGNRFDLILVAARRARQLSVQGKEALVEVENDK
FT                   STVVALREIEQGLINSAALDEQERQAQREQEAAELAAVAAIAEGRTL"
     atggcacggg ttactgtaga agacgccgta gacaagatcg gcaaccgttt tgacctgatc        60
     ctggtagcgg cacgtcgcgc tcgccaactg tccgtacagg gcaaagaggc gctggtggaa       120
     gtggaaaacg ataaatcaac cgtggttgcc ctgcgcgaaa tcgagcaagg cctgatcaac       180
     tctgccgccc tggacgagca agagcgtcag gcgcagcgcg agcaagaagc ggccgaactg       240
     gctgccgttg ccgcgatcgc cgaaggtcgt accctgtaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page