(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE112

CP002209.PE112       Location/Qualifiers
FT   CDS_pept        complement(136371..136994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0112"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="COGs: COG0194 Guanylate kinase; InterPro IPR008144:
FT                   IPR008145: IPR020590: IPR017665; KEGG: shm:Shewmr7_0330
FT                   guanylate kinase; PFAM: guanylate kinase; PRIAM: Guanylate
FT                   kinase; SMART: guanylate kinase/L-type calcium channel
FT                   region; SPTR: Q0HZX1 Guanylate kinase; TIGRFAM: guanylate
FT                   kinase; PFAM: Guanylate kinase; TIGRFAM: guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74326"
FT                   /db_xref="GOA:E1SW26"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW26"
FT                   /protein_id="ADN74326.1"
FT                   /translation="MARRGNLFILSAPSGAGKSSLISALLNDKPADMQVSVSHTTRAMR
FT                   PGEENGVHYHFVDVDEFKALIEQGAFFEWAEVFGNYYGTSRITIEQTLDRGIDVFLDID
FT                   WQGARQVKAQIPDAIGVFILPPSRAELERRLRSRGQDSDEIIAGRMAEAQSEISHYGEF
FT                   DYLLVNADFDTALSELRAIVCAERTRLARQVEAHGGMLDDLLAD"
     atggcacgtc gtggtaacct ttttatcctc tctgccccca gtggcgcagg gaaatcctcc        60
     cttatcagcg cactgctgaa cgacaaaccg gccgacatgc aggtgtccgt gtctcacacc       120
     acccgtgcca tgcgcccggg ggaggagaat ggcgtccatt accactttgt tgacgttgac       180
     gagttcaaag cgctgatcga acagggcgcc ttcttcgagt gggcggaagt gttcggcaac       240
     tactacggca cctcccgcat caccatcgag caaactctgg atcgcggcat cgacgtgttc       300
     ctcgacatcg actggcaggg cgcccgtcag gtcaaggcgc agatcccgga cgccatcggc       360
     gtgttcattc tgccgccctc ccgggccgag ctggaacgcc gtctgcgcag ccgcggtcag       420
     gacagcgacg agatcattgc cggccgaatg gcggaagccc agagcgaaat ctcccactac       480
     ggtgagttcg actacctgct ggtgaacgcc gattttgata ccgctttgag tgagttacgc       540
     gccattgttt gcgcagagcg cactcgcctt gctaggcagg ttgaggcaca cggtggtatg       600
     ctagatgatc tgttggcaga ctag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page