(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE113

CP002209.PE113       Location/Qualifiers
FT   CDS_pept        137269..137748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0113"
FT                   /product="Ferritin Dps family protein"
FT                   /note="COGs: COG0783 DNA-binding ferritin-like protein
FT                   (oxidative damage protectant); InterPro IPR002177:
FT                   IPR008331; KEGG: ilo:IL2352 ferritin-like DNA-binding
FT                   protein; PFAM: Ferritin Dps family protein; SPTR: A0Y4D7
FT                   DNA-binding DPS protein; PFAM: Ferritin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74327"
FT                   /db_xref="GOA:E1SW27"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW27"
FT                   /protein_id="ADN74327.1"
FT                   /translation="MNTNLIGLDKVGAEALAEQLNHLLANYQVLYMNVRGFHWNVQGAN
FT                   FFELHAKFEEIYDQLLLKVDEIAERILTLGHQPRHGFSDYLRMSQIDEVKGVRDGHVAI
FT                   EHILSAYTLLLSQQRKILSQASELGDEGTVSLMSDYISQQEKESWMLSAYQGRGA"
     atgaacacca acctgattgg actggacaaa gtgggcgcag aggccctggc tgaacaactg        60
     aaccacctgc tggccaacta ccaggtgctg tacatgaacg tgcgcggctt ccactggaac       120
     gtgcagggcg ccaacttctt cgagctgcac gccaagttcg aagagatcta cgaccagctg       180
     ctgctgaaag tggatgaaat cgctgagcgc atcctgaccc tgggtcacca gcctcgtcac       240
     ggcttctccg attacctgcg gatgagccag atcgacgaag tgaaaggggt gcgtgacggc       300
     catgtggcga ttgagcacat cctcagcgcc tacaccttgc tgctgagcca gcaacgcaaa       360
     atcctgtccc aggccagtga gctgggcgac gagggcaccg tttcgctgat gagtgactac       420
     atcagccagc aggagaaaga gtcctggatg ctgtccgcct atcagggccg tggcgcctga       480
//

If you have problems or comments...

PBIL Back to PBIL home page