(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE114

CP002209.PE114       Location/Qualifiers
FT   CDS_pept        complement(137730..138698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74328"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW28"
FT                   /protein_id="ADN74328.1"
FT                   /translation="MKNVELNLHNLVRITGHLPQPLLTPLMERFGRFRGDASAAPWEIE
FT                   LGILDAPGYRLRSRPGWVFDEIGAHWLGRSRKRLVIQATERGFRLLVRAPHYGRLHFGL
FT                   LWALRILMARQGGALMHGAVLGNGQHTLMLLGAKRVGKTQLVLRLMEQQWQLLAEDKFL
FT                   FLHGQAYCLQDHFYLRAHHLHSHPWLPGMLGQPERPARRTGEAQWRAGVETLYPGQLAL
FT                   TLRPDRLAWLSPGEQWQHQPISPTALRQALVQQQRDAFAQFAALDQWQGDPVSLPDDLP
FT                   LTGARHYLVPQPIDITVGCQSLRQWLQAATPTEGDAQAPRP"
     atgaaaaacg tcgagcttaa tcttcataac ctggtgcgca tcaccggcca cctgccccaa        60
     cccctgctga cgccattgat ggagcgcttt ggccgctttc gtggcgatgc cagcgccgcc       120
     ccctgggaga ttgagctggg gatactggat gcaccgggct accgactgcg atcccgtccc       180
     ggatgggtgt ttgatgagat tggcgcccat tggttgggcc ggtccagaaa acgcctggtg       240
     attcaggcca ccgaacgggg attccgcctg ctggtcagag cgccccacta tggccgcctt       300
     cactttggcc tgctgtgggc gttacgcatc ctgatggcgc gccagggcgg cgcattgatg       360
     cacggtgcgg tattggggaa tgggcaacat accctgatgt tgctgggggc caagcgggtg       420
     ggtaaaaccc aactggtgtt gcgcctgatg gagcagcaat ggcagctgct ggccgaggac       480
     aagttcctgt ttcttcatgg ccaggcctac tgcctgcagg atcacttcta cctgcgtgcc       540
     caccacctgc acagccaccc ctggttgcct ggtatgctgg gccaaccgga gcggccagca       600
     cggcgtaccg gcgaagccca atggcgggca ggagtggaaa ccctctatcc gggccaactg       660
     gcgctgacat tgcgaccgga ccggttggcc tggctgagcc ccggtgagca atggcaacat       720
     cagccaatct caccaaccgc gttgcgccag gccttggtgc aacagcagcg ggacgccttt       780
     gcccagttcg cagcgctgga tcagtggcag ggagaccctg tctccctgcc tgacgacctg       840
     ccgctcactg gcgcccgtca ctatctggtg ccgcaaccca tcgacattac cgtcggctgt       900
     caatcgctcc gacaatggtt acaggcagcg acaccaaccg aaggcgacgc tcaggcgcca       960
     cggccctga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page