(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE12

CP002209.PE12        Location/Qualifiers
FT   CDS_pept        complement(16389..18542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0012"
FT                   /product="fatty oxidation complex, alpha subunit FadB"
FT                   /EC_number="5.1.2.3"
FT                   /note="COGs: COG1250 3-hydroxyacyl-CoA dehydrogenase;
FT                   InterPro IPR001753: IPR006176: IPR006108: IPR006180: IPR
FT                   018376: IPR012799; KEGG: saz:Sama_0032 multifunctional
FT                   fatty acid oxidation complex subunit alpha; PFAM:
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; Enoyl-CoA
FT                   hydratase/isomerase; 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; SPTR: A1S1I8 Fatty acid oxidation complex subunit
FT                   alpha; TIGRFAM: fatty oxidation complex, alpha subunit
FT                   FadB; PFAM: Enoyl-CoA hydratase/isomerase family;
FT                   3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD binding domain;
FT                   TIGRFAM: fatty oxidation complex, alpha subunit FadB"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74226"
FT                   /db_xref="GOA:E1SUM1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM1"
FT                   /protein_id="ADN74226.1"
FT                   /translation="MIFESNALSVDWLEPGIAQMTFDAEGSVNKFDRNTLTHFHNALNV
FT                   LHDLPDLKGLVVASAKGAFIVGADITEFLTLFAEPESVLQHWLEETNLIFNKLEDLPVP
FT                   TIAAINGYALGGGCEAILACDLRVADSSARIGLPETKLGLIPGFGGTVRLPRVIGADNA
FT                   LEWITTGKEHRPDAALQVGAIDAVVAPDALSSAAVAMLKRAIAGEIDWQSRRARKQAPL
FT                   TLSKIEAAMSFTTAKGMVAMKAGPHYPAPHAAVALIEQVSGQGRAEALQGEHAAFIKLA
FT                   KTDVATALIGLFLNDQYVKGKAKKATKLAKPVEQAAVLGAGIMGGGIAYQSAVKGTPVV
FT                   MKDIAQPALDLGLNEAAKLLGKQVERGRLKPDGMAKVLNNIVPSLDYAPVAHADVVVEA
FT                   VVENPKVKGIVLAEVEGVVAEDAVLASNTSTISIDLLAQSLKRPENFCGMHFFNPVHRM
FT                   PLVEVIRGAKTSDETVAKVVAYAAKMGKTPIVVNDCPGFFVNRVLFPYFAGFSLLLKEG
FT                   ADFQQIDKVMSKQFGWPMGPAYLLDVVGIDTAHHCLDVMAAGFPERMGKMENDPVDLMF
FT                   KADRYGQKNGKGFFQYAPDRKGKPKKTVDDAALAMLTDAYGAPKSFDAETIIARTMVPM
FT                   INETVRCLEEGIVASPAEADMALLYGIGFPAFRGGIFRYLDTIGLDRFVAMADQYAHLG
FT                   PLYQVTDKLREMAAQGARFYQGQ"
     atgatctttg agagtaatgc cctcagcgtc gattggctgg aacccggcat cgcccagatg        60
     accttcgatg ccgaaggctc cgtcaacaag ttcgaccgca acaccctgac gcacttccac       120
     aacgccctca atgttctcca tgacctgcct gacctgaagg gcctggtggt ggcgtccgcc       180
     aaaggcgcgt ttatcgtcgg tgccgacatc accgaattcc tgaccctgtt tgctgagccc       240
     gaatcggtgc tgcaacactg gctggaagag accaacctca tcttcaataa gctcgaagat       300
     cttccggttc ccaccattgc tgccatcaat ggctacgctc tgggtggcgg ctgcgaggcg       360
     attctcgcct gtgaccttcg agtggcggac agcagcgccc gcatcggcct gccggaaacc       420
     aagctgggcc tgatccccgg ctttggcggc accgttcgcc tgccccgcgt gattggcgcc       480
     gataatgcgc tggagtggat caccaccggt aaagagcacc gccctgacgc ggcgctgcag       540
     gtgggtgcca ttgacgccgt agtggcaccg gacgcgctca gcagcgccgc cgtggccatg       600
     ctgaaacgtg ccattgccgg tgagatcgac tggcagagcc gtcgtgcccg caagcaggct       660
     cccctgaccc tctccaagat tgaagcggcc atgtcgttca ccaccgccaa aggtatggtg       720
     gcgatgaaag ccggcccgca ctaccccgcc ccacacgctg cagtcgcgct gattgagcag       780
     gtgtccggcc agggtcgtgc tgaagcgttg cagggtgaac acgccgcctt tattaagctg       840
     gccaaaaccg atgtggccac tgcgctgatc ggcctgttcc tcaacgacca gtacgtcaaa       900
     ggcaaagcca agaaagccac caagctggcc aaaccggtcg agcaggcagc ggtactgggt       960
     gccggcatta tgggtggcgg catcgcctac cagtctgccg tgaaaggcac cccggtggtg      1020
     atgaaagaca tcgcccaacc ggcgcttgat ctcggcctga acgaagccgc caagctgctg      1080
     ggtaagcagg ttgagcgcgg tcgtctcaag cccgatggca tggccaaggt actgaacaac      1140
     atcgtgccca gcctggatta cgccccggtg gcccacgccg acgtggtggt ggaagcggtg      1200
     gtggagaatc ccaaggtgaa agggattgtg ctggccgaag tggaaggcgt cgtggcggag      1260
     gatgcggtgc tcgcgtccaa cacctccacc atctccatcg acctgctggc ccagagcctc      1320
     aagcgtccgg agaacttctg cggtatgcac ttcttcaacc cggtgcatcg tatgcccctg      1380
     gttgaggtga ttcgcggtgc caagaccagc gacgagaccg tggccaaagt ggtcgcctac      1440
     gccgccaaga tgggcaaaac ccccatcgtg gtcaacgact gccccggctt cttcgttaac      1500
     cgtgtgctgt tcccctactt cgccggtttc agcctgctgc tgaaagaggg cgccgacttc      1560
     cagcagatcg acaaagtcat gagcaagcag tttggctggc cgatgggccc ggcttacctg      1620
     ctcgacgtgg tcggcatcga caccgcccac cactgcctcg acgtaatggc tgccggtttc      1680
     ccggagcgta tgggcaagat ggaaaacgat ccggttgacc tgatgttcaa ggctgaccgc      1740
     tacggccaga agaatggcaa aggcttcttc cagtacgccc cggaccgcaa gggcaagccg      1800
     aagaagaccg ttgatgacgc ggcgctggcc atgctgaccg acgcctacgg cgcacccaag      1860
     tcgttcgatg ccgaaaccat catcgcccgc accatggtgc cgatgatcaa cgaaaccgtg      1920
     cgctgcctcg aagagggcat cgtcgcctcc ccggcggaag ccgacatggc actgctgtac      1980
     ggtatcggtt tccccgcctt ccgcggcggc atcttccgct acctggatac catcggcctc      2040
     gaccgctttg tcgccatggc cgaccagtac gcccacctgg gcccgctgta ccaggtcacc      2100
     gataaactcc gtgaaatggc cgcccagggc gctcgtttct atcaaggaca gtaa            2154
//

If you have problems or comments...

PBIL Back to PBIL home page