(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE122

CP002209.PE122       Location/Qualifiers
FT   CDS_pept        complement(148183..149184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0122"
FT                   /product="sugar transferase"
FT                   /note="COGs: COG2148 Sugar transferase involved in
FT                   lipopolysaccharide synthesis; InterPro IPR003362; KEGG:
FT                   dat:HRM2_32260 predicted glycosyltransferase; PFAM: sugar
FT                   transferase; SPTR: A3VTM1 Putative uncharacterized protein;
FT                   PFAM: Bacterial sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74336"
FT                   /db_xref="GOA:E1SW36"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW36"
FT                   /protein_id="ADN74336.1"
FT                   /translation="MSQIVSRSISALFPKQRWSRTLELTAAWLMLLCALPMGLVFALII
FT                   KLQDGGPVFYRGTRLGKDRKLFTLYKFRTLVPNAEAIIGANLLKPSQQLETPFGKFLRD
FT                   THLDELPQVLCVIKGDMALIGPRPERPAVYETMCREIPFYDHRFRVAPGMLGYSQLFTP
FT                   HGTDKRIRSFIDNVYINRRRLHSDLLFFFQASLVLTQRLVRHCWRLLKITGGRVMFGQQ
FT                   WSERRHTRRHKPRYAKVHIQCQPPVQGHIVNITYDAMLIALSHPLENPEAELELVLRTH
FT                   FIRKARFRTKLCRVRGTVISARSTPEEPHCYLVRIAEATPLNRYFLSKYFMS"
     atgagtcaga ttgtgtcccg ttccatcagt gcgctgtttc ccaaacagcg ctggagccga        60
     acgctggagc tgacagccgc ctggctgatg ctgctgtgcg ccctgcccat gggcctggtg       120
     tttgccctga tcatcaagct gcaggatggc ggcccggtgt tttaccgcgg cacccgtctg       180
     ggcaaagatc gtaagctgtt cacgctgtat aagttccgca ccttggtgcc caatgccgaa       240
     gcgatcatcg gggccaacct gctcaagcca agccagcagc tggaaacccc ttttggtaag       300
     ttcctgcgcg atacccatct ggatgaactg ccccaggtgc tgtgcgtgat caaaggcgat       360
     atggcgctga ttggcccgcg cccggaacgg ccagcggtgt acgaaaccat gtgccgcgag       420
     atcccgtttt acgaccaccg ttttcgggtc gccccgggca tgctgggtta ctcccagctg       480
     tttacccccc acggcaccga taagcgcatc cgcagcttta tcgacaacgt ctacatcaac       540
     cgccgtcgac tgcactccga cctgctgttc ttcttccagg ccagcctggt gctgacccag       600
     cgtctggtgc gccactgctg gcgcctgctg aagatcaccg gcggccgtgt catgttcggc       660
     caacagtgga gcgagcggcg ccatacccgc cgccataagc cacgctacgc caaagtccat       720
     atccagtgtc agccgccggt gcagggccac atcgtcaaca tcacttacga tgccatgttg       780
     atcgccctgt cccatccgct ggagaaccct gaggccgagc tggagctggt tctgcgcacc       840
     cactttatcc gcaaggcccg tttccgcacc aagctgtgcc gggtgcgcgg caccgtgatc       900
     agcgcccgca gcacgccgga agagccccac tgttatctgg tgcgcattgc cgaagccacg       960
     ccgctgaacc gttacttcct cagcaaatac tttatgagct ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page