(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE123

CP002209.PE123       Location/Qualifiers
FT   CDS_pept        complement(149181..150620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0123"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="COGs: COG3206 Uncharacterized protein involved in
FT                   exopolysaccharide biosynthesis; InterPro IPR003856; KEGG:
FT                   pfo:Pfl01_2020 lipopolysaccharide biosynthesis; PFAM:
FT                   lipopolysaccharide biosynthesis protein; SPTR: A3L961
FT                   Putative uncharacterized protein; PFAM: Chain length
FT                   determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74337"
FT                   /db_xref="GOA:E1SW37"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW37"
FT                   /protein_id="ADN74337.1"
FT                   /translation="MQNVSNASWERNAQGTENPLRELVTILFMQKWLIQRVAALVFLAV
FT                   LAVLLFWPSVYQIDSTVLLKSKQVETSPEMLEETMLRVNPVNEDDLNSEVAIITSQAVL
FT                   RRAVNKMVEQGLWQAPEEEADLVKATRGLEAKLTTQVVPSSKVIRISLAWSDPEEGNAL
FT                   LTAVINSYLSYRSTVFEPDTLRDLFTQQTEDYSSQLQQRRAEKMALIETHQAAAPAQEI
FT                   EQNLTLLRELKLQHSRLEQEAQSLNHREQKLTQALNENALHYFSFIDNVTVQKLTTEIQ
FT                   MLVARQTELEQVYLPESPPAEALDHQIEQTYQILRDEIGTLQQELADQVALLRADINSL
FT                   NQKMLTLSQRNVELQQVKLQMERLDQEIKLLGFSYETFYKRREQAQIQSRFSDEHLNAQ
FT                   VVVLVPPEAQLEPLFPRWKTMLPLGLLVALITGVCIGFINEFFDHSFKRAEDSERHLGL
FT                   PTLLSIPQIDAAPQPTAKGHR"
     atgcagaacg tgagcaacgc ttcctgggag cgaaatgccc agggcaccga gaacccgttg        60
     cgggagctgg tcaccatcct gtttatgcag aaatggctga tccagcgggt cgcggcgctg       120
     gtgttcctcg ccgtactggc ggtgctgctg ttctggccct cggtttacca gatcgactcc       180
     accgtgctgc tcaagtccaa gcaggtggag acgtcaccgg agatgctgga agagaccatg       240
     ttgcgggtca acccggtcaa cgaggatgac ctgaactccg aagtcgccat catcacctcg       300
     caggcggtac tgcgccgcgc ggtgaacaag atggttgagc aggggctgtg gcaggcgccg       360
     gaagaggaag ccgatctggt taaagccacc cgtggcctgg aagccaagct gaccacgcaa       420
     gtggtgccct cctccaaggt gatccggatc agcctggcct ggtctgatcc ggaagagggc       480
     aatgccctgc tgacggcggt gatcaacagc tacctgtcct accgcagcac ggtgtttgag       540
     ccggacaccc tgcgtgacct gtttacccag cagaccgaag actacagcag tcagctgcag       600
     caacgccggg ctgagaagat ggcgctgatc gagacccacc aggcggccgc gcccgctcag       660
     gagatcgagc agaatctgac gctgcttcgc gaactgaagc tgcagcacag ccgactggag       720
     caggaagcgc agagccttaa tcaccgtgag cagaagctga cccaggcgct gaacgagaat       780
     gccctgcact acttctcctt tatcgataat gtcacggtgc agaagttgac cactgagatc       840
     cagatgctgg tggcccgtca aaccgagctg gaacaggtgt atctgccgga atcgccaccg       900
     gccgaggcgc tggatcacca gattgagcag acctaccaaa tcctgcgtga cgagatcggc       960
     accctgcagc aggaactggc tgatcaggtg gcgctgttgc gcgccgacat caacagcctg      1020
     aaccagaaga tgctgaccct gagccagcgc aacgtcgaac tgcagcaagt gaagctgcag      1080
     atggagcggc tggaccagga gattaagctg ctgggcttct cctacgaaac cttctacaag      1140
     cgccgcgaac aggcccagat ccagagtcga ttcagcgacg aacacctcaa tgctcaggtg      1200
     gtggtactgg tgccgccgga ggctcagctg gagcccctgt tcccgcgctg gaaaaccatg      1260
     ctgccgctgg gcttgctggt ggcattgatc accggtgtct gcatcggctt tatcaacgag      1320
     ttcttcgacc acagctttaa gcgtgccgag gactccgagc gccacctcgg tctgccgacc      1380
     ctgctgtcga ttccgcagat cgatgccgcc cctcagccca ctgccaaagg tcatcgatga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page