(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE128

CP002209.PE128       Location/Qualifiers
FT   CDS_pept        154578..155219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0128"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="COGs: COG0461 Orotate phosphoribosyltransferase;
FT                   InterPro IPR000836: IPR002375: IPR004467; KEGG:
FT                   sfr:Sfri_3835 orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; PRIAM: Orotate
FT                   phosphoribosyltransferase; SPTR: A2UXM9 Orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyl transferase
FT                   domain; TIGRFAM: orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74342"
FT                   /db_xref="GOA:E1SW42"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW42"
FT                   /protein_id="ADN74342.1"
FT                   /translation="MKAYQKAFIEFALERQVLRFGEFTLKSGRTSPYFFNAGLFNRGSD
FT                   LAKLGRFYAAALADSGIDFDLLFGPAYKGIPIATTTAVALADHHEMDLPYCFNRKEAKD
FT                   HGEGGNLVGAELKGKVMLVDDVITAGTAIRESMEIIQHNGAELAGVLIALDRQEKGKGE
FT                   LSAIQEVERDFGCQVVSIVTLSDLISFLAEQPGREAELAAVKAYREQYGI"
     gtgaaagcct accaaaaagc ctttatcgaa tttgcccttg agcgccaggt gctgcgtttt        60
     ggcgagttca ccctgaagtc cggccggacc agcccctact tctttaatgc gggtctgttt       120
     aaccgcggct ccgatctggc caagctgggc cgtttctacg ctgccgccct ggcggattcc       180
     ggcatcgatt tcgacctgct gttcggcccg gcctacaaag gcatcccgat cgccaccacc       240
     actgcggtgg cgctggccga ccatcacgag atggacctgc cctactgctt taaccgcaaa       300
     gaggccaaag accacggcga aggcggtaac ctggtgggcg ctgagctgaa gggtaaggtg       360
     atgctggtgg atgacgtgat cactgccggt accgccatcc gtgagtccat ggagatcatc       420
     cagcacaacg gcgcagaact ggccggtgtt ctgatcgcgc tggaccgtca ggagaagggc       480
     aagggcgagc tgtctgccat tcaggaagtg gagcgtgact ttggctgcca ggtggtgtcc       540
     atcgtgaccc tgtccgacct gatcagcttc ctggcggagc aaccgggccg tgaagcggaa       600
     ctggcagcgg taaaagccta ccgtgagcag tacggcatct ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page