(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE132

CP002209.PE132       Location/Qualifiers
FT   CDS_pept        157622..158305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0132"
FT                   /product="DNA repair protein RadC"
FT                   /note="COGs: COG2003 DNA repair protein; InterPro
FT                   IPR001405; KEGG: aha:AHA_0160 DNA repair protein RadC;
FT                   PFAM: DNA repair protein RadC; SPTR: A0KEM8 DNA repair
FT                   protein radC homolog; TIGRFAM: DNA repair protein RadC;
FT                   PFAM: Protein of unknown function (DUF2466); TIGRFAM: DNA
FT                   repair protein radc"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74346"
FT                   /db_xref="GOA:E1SW46"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW46"
FT                   /protein_id="ADN74346.1"
FT                   /translation="MDGKSIAQWPASERPRERLLKQGPEALSDAELLAIFLRTGVPGTS
FT                   AVALARQLLDEFGDLGHLLNASKQQFCAIRGLGEAKYVQLHATLELARRYLAVQWQRGE
FT                   PLTSPQAVRDYLRHRLQGLEEERFMLLLLDSQHRVLQTIELSRGTIDAAQVYPREVVKT
FT                   ALKANAAAVILAHNHPSGVAEPSQADRHITGRIQQALALVDVSVLDHLVVGRGQSCSFA
FT                   ERGWL"
     atggacggta aatcgatagc ccaatggccc gcgtcagaac gacctcgaga acgtttactg        60
     aaacaggggc cggaagcgtt aagtgacgcc gaattgctgg cgatttttct tcgcaccggc       120
     gtgccgggca ccagcgctgt ggccctggcc cggcagttac tcgatgagtt tggcgatttg       180
     ggtcacttgt tgaatgcgtc gaagcaacaa ttttgcgcaa ttcgtggcct tggcgaagcg       240
     aaatacgtac aattgcatgc caccttggaa ctggcccgcc gctatcttgc ggtgcagtgg       300
     caacgcggtg aaccgctgac ctcgccacag gccgtccggg attaccttcg gcatcgcctt       360
     caggggttgg aagaggaacg ttttatgctg ctgttgttag acagccagca tcgcgtgctt       420
     cagaccattg aactctcacg cggcaccatt gacgcggccc aggtttaccc ccgggaagtg       480
     gtcaagactg cgctgaaagc gaatgcggcg gcggtgatac tggcccacaa ccacccttct       540
     ggggtggccg agcccagcca agccgaccgt catattaccg gccgaatcca gcaggctctg       600
     gccctggtgg acgtttccgt actcgaccac ctggtggtcg gacggggaca atcctgctcc       660
     tttgccgaac gaggttggct gtga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page