(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE135

CP002209.PE135       Location/Qualifiers
FT   CDS_pept        159137..159604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0135"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_3689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74349"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW49"
FT                   /protein_id="ADN74349.1"
FT                   /translation="MARSRRTYNNWLIFLVIGAGALLFSTGRLTGPNSNSFPLLPESAE
FT                   IEALVYGDLVVRAEADGVRSSPVVSEARLNALLAAWRSARLVPVGEPQPLPDSPVQVDV
FT                   YLDDGSAPQTALLYPQQAAVKMLGQSQWWRLVNQEMQHLLPPDNTAAPASK"
     atggctcgat cccgaagaac ttataacaac tggctcattt ttctggtgat aggggctggt        60
     gcattgctgt tttccactgg tcgactcacc ggtccgaaca gcaacagctt tcctttgctg       120
     cctgagtcag ctgagatcga agcgctggtt tatggcgacc tggtggtgcg cgccgaagcc       180
     gatggggttc gctccagccc ggtggtcagt gaagcccgcc tgaatgctct gctggcggcc       240
     tggcgttcgg cccgcctggt accggtgggc gaaccgcaac cgctgcctga cagcccggta       300
     caggtggatg tctacctgga tgatggttcc gcaccgcaaa ccgcgttact gtacccgcaa       360
     caagcggctg tgaagatgtt ggggcagtct cagtggtggc gcctggtgaa ccaggagatg       420
     cagcatctgc tgccccccga caacacggcc gctcctgcat cgaaataa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page