(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE137

CP002209.PE137       Location/Qualifiers
FT   CDS_pept        complement(160431..160916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0137"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="COGs: COG0669 Phosphopantetheine
FT                   adenylyltransferase; InterPro IPR001980: IPR004820:
FT                   IPR004821; KEGG: amc:MADE_00059 phosphopantetheine
FT                   adenylyltransferase; PFAM: cytidylyltransferase; PRIAM:
FT                   Pantetheine-phosphate adenylyltransferase; SPTR: B4S2C7
FT                   Phosphopantetheine adenylyltransferase; TIGRFAM:
FT                   pantetheine-phosphate adenylyltransferase;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   Cytidylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase, bacterial; cytidyltransferase-related
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74351"
FT                   /db_xref="GOA:E1SW51"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW51"
FT                   /protein_id="ADN74351.1"
FT                   /translation="MSQTAIYPGTFDPITNGHLDLIQRASRMFDRVIVGIAASPSKRPL
FT                   FTLEQRVELVNAVVAELGNVEVVGFSGLLADFAREQNARVLIRGLRAVSDFEYEFQLAN
FT                   MNRRLNPELESVFLTPSEENSFISSSLVKEVALHGGNVTEFLPEVVQNALKDALAKR"
     atgagccaaa ccgcaattta ccccggcaca tttgacccca ttaccaacgg ccacctggac        60
     ctgatccaac gggccagccg catgtttgat cgggtgatcg tcggcatcgc cgccagcccc       120
     tcaaagcgcc ctctgtttac cctggagcaa cgggttgagc tggtgaacgc cgtcgtggca       180
     gaactgggca acgtcgaagt ggtgggattc tccggcctgc tggccgattt tgcccgggag       240
     cagaatgccc gggtgctgat ccgcggcctg cgcgcggtgt ccgactttga gtacgagttc       300
     cagctggcca atatgaaccg ccgcctgaac ccggaattgg aaagcgtgtt cctgaccccg       360
     tccgaggaga actcctttat ctcctccagc ctggtcaaag aggtggcgct gcacggtggc       420
     aacgtcaccg agttcctgcc cgaagtggtc caaaacgccc tcaaggacgc cctggcaaaa       480
     cgctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page