(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE139

CP002209.PE139       Location/Qualifiers
FT   CDS_pept        complement(162095..163150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0139"
FT                   /product="glycosyl transferase family 8"
FT                   /note="COGs: COG1442 Lipopolysaccharide biosynthesis
FT                   protein LPS:glycosyltransferase; InterPro IPR002495; KEGG:
FT                   cju:C8J_1341 hypothetical protein; PFAM: glycosyl
FT                   transferase family 8; SPTR: A1XRC1 Glycosyltransferase;
FT                   PFAM: Glycosyl transferase family 8"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74353"
FT                   /db_xref="GOA:E1SW53"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW53"
FT                   /protein_id="ADN74353.1"
FT                   /translation="MTHPQMNIVLSGDDNYSKYMAVTMQNIVHFLAPGTKVNFLILDSG
FT                   IRPESKAKLQQFADTLDQVQIHIFDIVEHYADELAKLAPYRHGSKKNTITAGTYGLFFV
FT                   AEAFPEFDKALYIDVDVIVRQNLQPAFDTDIEDKYGAVVRMLTHAQLGSLKSSRSGKPF
FT                   PQNFQDLFGKSSENYFNAGVQLLNLKRMREEKVKDQLSDTLTNIPLEVFHTEVNYHNQD
FT                   IFNAVFAGKVAFLPTRYNCQVKNVNKIKRRFLRLGLDFSEFQPEFENPAIIHYSGRRKP
FT                   WNDKNLFASELWWDAASRTPFAEEINQKYQQDLSKKLKTAKGLLNWLFDFRLDKNQKHI
FT                   KLFGITLLRDH"
     atgacccacc cgcagatgaa catcgtgctg tccggcgacg acaactattc caagtacatg        60
     gccgtcacca tgcagaatat tgtccacttc ctggccccgg gcaccaaggt gaactttctg       120
     atcctggatt ccggcatccg cccggaaagc aaagccaaac tgcagcagtt tgccgacacg       180
     ctggatcagg ttcagatcca catcttcgac atcgtggagc actacgctga cgagctggcc       240
     aaactggcgc cctaccgtca cggcagcaaa aagaacacca tcactgccgg cacttacggt       300
     ctgttctttg tggcagaagc cttccccgag ttcgacaagg cgctctatat cgacgttgat       360
     gtcatcgtgc gccagaacct gcaaccggcc tttgataccg atatcgagga caagtacggc       420
     gcggtggtgc gaatgctgac ccacgcccag ctggggtctc tcaaatcctc ccgctccggc       480
     aagccgttcc cgcagaactt tcaggacctg tttggcaaga gcagcgagaa ctacttcaat       540
     gcgggcgtgc agctgctgaa cctgaagcgg atgcgggaag agaaggtgaa ggaccaactg       600
     tccgataccc tgaccaatat ccccttggag gtgttccaca ccgaggtgaa ctaccacaat       660
     caggacatct tcaatgcggt gtttgccggc aaggtcgcgt tcctgccgac ccgatacaac       720
     tgccaggtga agaacgtgaa caagattaag cgtcgcttcc tgcgcctggg cctggatttc       780
     tccgagttcc agcccgagtt cgaaaacccg gccatcattc actactctgg ccgccgcaag       840
     ccctggaatg acaagaacct gtttgcctcc gagctgtggt gggatgccgc cagccgcacc       900
     ccctttgccg aagagattaa ccagaaatat cagcaggacc tgagtaaaaa actgaaaacc       960
     gccaaggggc tgcttaactg gctgttcgac ttccgactcg acaagaacca gaagcacatc      1020
     aagctgttcg gcatcacgct gttgcgggac cactaa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page