(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE140

CP002209.PE140       Location/Qualifiers
FT   CDS_pept        163406..164314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0140"
FT                   /product="glycosyl transferase family 2"
FT                   /note="InterPro IPR001173; KEGG: bac:BamMC406_4102 glycosyl
FT                   transferase family protein; PFAM: glycosyl transferase
FT                   family 2; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74354"
FT                   /db_xref="GOA:E1SW54"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW54"
FT                   /protein_id="ADN74354.1"
FT                   /translation="MRIQDQLTIYIFSFNRGRFLSNAIDSCLRYAPGVPVHVIDDNSDD
FT                   PDTLAVLNNLPEGVSWVKPQARGDDRHGGLYNNMQQALDSVTSEWILFIQDDMQLVRPL
FT                   EQDDAQYIADFFQQFPEKGFLNPVFLKGQRHKRDNRITRVFEDFHGYYRHYPEKKNPRG
FT                   ISYADVVIGHAGRLKAKGWQFSASEQTNASQANEMFGGMGFMAHPFVMFLPQVPVYRGK
FT                   KKTAAVALAEKWSGMEPKRFVEQSAEHWAGFKRRPLTELPVAETYLQCVDPKVKTPYQY
FT                   SAVNAYWPLRAWHKLALLLNK"
     atgcggattc aagaccagtt aacgatttac atcttctcct tcaatcgtgg acgttttctc        60
     agcaacgcca tcgactcctg tttgcgttac gcgcccggcg tgccggtaca cgtgattgac       120
     gacaacagcg atgacccgga tacccttgcg gtgctgaaca atctgcctga aggggtcagc       180
     tgggtgaagc cgcaggcccg cggtgatgac cgccacggtg gtctctacaa caacatgcag       240
     caggcgctgg acagcgtcac cagcgagtgg attctgttta tccaggacga catgcagctg       300
     gtgcgtccac tggagcagga tgatgcccag tacatcgcgg attttttcca gcagttcccc       360
     gaaaaggggt ttctgaatcc ggtgttccta aaagggcagc gccataagcg cgacaaccga       420
     atcacccgcg ttttcgagga tttccacggc tattaccgtc attatcctga gaagaaaaac       480
     ccccgcggca tcagttatgc cgatgtggtg attggccatg ccggtcgcct taaggccaag       540
     ggctggcagt tcagtgccag tgagcaaacc aatgccagtc aggccaatga gatgtttggc       600
     ggcatgggct ttatggcgca cccctttgtg atgtttctgc ctcaggtgcc ggtgtaccgg       660
     ggcaaaaaga aaaccgcggc ggtggcgctg gcggagaagt ggtctggcat ggagccaaag       720
     cgctttgtgg aacaaagtgc cgagcactgg gccgggttta agcgccgtcc gctgaccgaa       780
     ctgccggtgg ccgaaaccta tctgcagtgt gtcgacccca aggtgaagac cccctaccag       840
     tacagtgcgg tgaacgcgta ctggccgctg cgggcctggc acaaactggc tttgctgttg       900
     aacaaataa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page