(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE147

CP002209.PE147       Location/Qualifiers
FT   CDS_pept        complement(170014..171354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0147"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="COGs: COG1004 UDP-glucose 6-dehydrogenase; InterPro
FT                   IPR014027: IPR014026: IPR001732: IPR017476; KEGG:
FT                   avn:Avin_27790 UDP-glucose 6-dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; PRIAM: UDP-glucose
FT                   6-dehydrogenase; SPTR: A3JJ75 Predicted UDP-glucose
FT                   6-dehydrogenase; TIGRFAM: nucleotide sugar dehydrogenase;
FT                   PFAM: UDP-glucose/GDP-mannose dehydrogenase family, NAD
FT                   binding domain; UDP-glucose/GDP-mannose dehydrogenase
FT                   family, central domain; UDP-glucose/GDP-mannose
FT                   dehydrogenase family, UDP binding domain; TIGRFAM:
FT                   nucleotide sugar dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74361"
FT                   /db_xref="GOA:E1SW61"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW61"
FT                   /protein_id="ADN74361.1"
FT                   /translation="MKVTVFGVGYVGLVQASVLADVGHEVCCVDVDQDKVDRLNQGLIP
FT                   IYEPGLEPMVRHNHDAGRLTFTTDAAAGVHHGKVQFIAVGTPPDEDGSADLQYVLAVAD
FT                   TIARHMDSPKVVVDKSTVPVGTADKVRQRIASVLKERGADVAFQVVSNPEFLKEGAAVA
FT                   DCMRPDRIVIGSDDEVAIEVMRELYEPFNRQQERTVIMDVRSAELTKYAANCMLATKIS
FT                   FMNEMANLAEKLGADIEAVRRGIGSDPRIGYHFIYPGCGYGGSCFPKDVQALIRAADGI
FT                   GHDAKILKAVEQVNDDQKTVLMRNIRRHFGDDLKGRTIALWGLAFKPNTDDMREAPSRV
FT                   LLAALWEAGARVQAYDPEAMEETQRIFGHRDNLVLMGTKEAALKGADALVICTEWQAFR
FT                   APDFDFIQQELRQPVIFDGRNLYDPERLAKRGFHYYGIGRGLSITQE"
     atgaaagtaa cggtatttgg tgtgggctac gtgggcctgg tacaagcgtc ggtactggcc        60
     gacgtgggcc atgaggtgtg ctgtgtggat gtcgatcagg acaaggtcga ccgattgaat       120
     cagggcctga tccccatcta cgaacccggc cttgagccga tggtgcgcca caaccacgat       180
     gccggtcgcc tgacctttac caccgacgcc gccgccgggg ttcaccacgg caaagtgcag       240
     tttatcgccg tgggcactcc gccggatgag gatggcagcg ccgatctcca gtacgttctg       300
     gcggtggcgg acaccatcgc ccgccatatg gacagcccca aagtggtggt ggacaaatcc       360
     acggtgccgg tgggcaccgc cgacaaagtg cggcaacgga tcgccagtgt gctgaaagaa       420
     cgcggcgcgg atgtcgcctt tcaggtggtc tccaacccgg agtttctcaa agagggcgcc       480
     gcggttgccg attgcatgcg gccggaccgt atcgtgatcg gcagtgatga tgaggtggcc       540
     attgaggtga tgcgggagtt gtacgaaccc tttaatcgcc agcaggaacg caccgtcatc       600
     atggacgtgc gcagcgctga actgaccaag tacgccgcca actgcatgct ggccaccaag       660
     atctccttta tgaacgagat ggccaacctg gccgaaaagc tgggcgccga tatcgaagcg       720
     gtgcgccggg gcatcggctc agacccccgc atcggctacc actttatcta ccccggctgc       780
     ggttatggcg gctcctgctt tcccaaggat gtgcaggcgc tgatccgcgc cgctgacggc       840
     atcggccatg acgccaagat cctcaaggcg gtggagcagg tcaacgacga ccagaaaacc       900
     gtgctgatgc gcaacatccg ccgccacttc ggcgacgacc tcaagggcag aaccatcgcc       960
     ctgtggggac tggcctttaa gcccaacacc gacgacatgc gcgaagcgcc cagtcgggtg      1020
     ttgctggctg cactgtggga ggccggcgcc agagtgcagg cctatgaccc ggaagcaatg      1080
     gaggagaccc agcgcatctt cggtcatcgc gacaatctgg tgctgatggg caccaaggaa      1140
     gcggctctca agggggccga tgcgctggtg atctgcaccg aatggcaggc tttccgcgcc      1200
     cccgatttcg attttattca gcaggaattg cgccagcccg tgatttttga cggcagaaac      1260
     ctgtacgatc ccgagcgtct ggccaagcgc ggcttccatt actatgggat tggccgcggc      1320
     ctgagcatta cccaggagta a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page