(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE149

CP002209.PE149       Location/Qualifiers
FT   CDS_pept        172548..173279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0149"
FT                   /product="Mn2+dependent serine/threonine protein kinase"
FT                   /note="InterPro IPR002575: IPR010440; KEGG: swd:Swoo_0068
FT                   3-deoxy-D-manno-octulosonic-acid kinase; PFAM:
FT                   lipopolysaccharide kinase; aminoglycoside
FT                   phosphotransferase; SPTR: A0XXW1 Putative
FT                   lipopolysaccharide kinase family protein; PFAM:
FT                   Lipopolysaccharide kinase (Kdo/WaaP) family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74363"
FT                   /db_xref="GOA:E1SW63"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW63"
FT                   /protein_id="ADN74363.1"
FT                   /translation="MKILNFPPHRVYLAEAAPATLDANWFEPAWLREQGWVTGSSDSSG
FT                   RNPAWFFQQDDRRYVLRHYWRGGLPGKLFKDGYLYLGEQRSRPWQELSLMVALKAKGLP
FT                   VATPVAARLTRTGLNYRADLLTEMLPQSQDMVKHLSGGAMAAARWQALGAVLARFHREG
FT                   VYHADLNARNILLSQGEFFLIDFDRGELRNPATDWQQANLARLRRSLLKEQGRVAGLHY
FT                   DDAADWAALMAGYNSELASAS"
     atgaagatcc tcaacttccc cccacatcgc gtctatctgg cggaggccgc tccggcgacc        60
     ctcgatgcca actggtttga gccagcatgg ctgcgtgagc aggggtgggt gaccggcagc       120
     tctgacagct ccggccgtaa tccggcctgg tttttccagc aggatgaccg ccgctatgtg       180
     ctgcgccatt actggcgtgg tgggttgccg ggcaagctgt ttaaagacgg ttatctctac       240
     cttggtgagc agcgcagccg gccctggcag gagttgagcc tgatggtcgc gctgaaagcg       300
     aagggactgc cggtggccac gccggtggcg gcgcgcctga cccgcaccgg gctgaactac       360
     cgcgccgacc tgctgaccga gatgctgccg cagagccagg atatggtgaa gcacctgtct       420
     ggcggggcga tggccgcagc gcgttggcag gcgttgggcg ccgtgctggc gcgctttcat       480
     cgcgaagggg tgtaccacgc ggatctcaac gcccgcaaca tcctgcttag ccagggagag       540
     ttcttcctga tcgattttga ccggggagag ctgcgcaacc ccgccaccga ctggcaacag       600
     gccaatctgg cacgactgcg tcgctctttg ctgaaggagc agggccgggt ggccggcctg       660
     cactatgatg atgcggccga ctgggccgca ttgatggcgg gttacaacag cgaactggcc       720
     agcgccagct ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page