(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE15

CP002209.PE15        Location/Qualifiers
FT   CDS_pept        20710..22167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0015"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR003445: IPR004772; KEGG:
FT                   shm:Shewmr7_0019 TrkH family potassium uptake protein;
FT                   PFAM: cation transporter; SPTR: A2V478 Potassium uptake
FT                   protein, TrkH family; TIGRFAM: potassium uptake protein,
FT                   TrkH family; PFAM: Cation transport protein; TIGRFAM:
FT                   potassium uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74229"
FT                   /db_xref="GOA:E1SUM4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM4"
FT                   /protein_id="ADN74229.1"
FT                   /translation="MEYRTITRIIGLLVALFSTTMLPPALIAVIYKDGGGTTFVQAFVL
FT                   SLVLGLLLWYPNRDAKQELRSREGFLIVVLFWTVLGSIGAIPLVLADSPNLSFTDAMFE
FT                   AFSALTTTGATVITGLDNLPKAILFYRHLLQWLGGMGIIVLAVAVLPMLGVGGMQLYRC
FT                   ETPGPVKDNKMTPRIAETAKALWYIYLTLTIACALAYWLAGMNLFDAVGHAFSTVSIGG
FT                   FSSYDASMGHFDSRLINAICVVFLLIAGVNFSLHFTAFGRRGVNLKTYFRDTEVKVFLG
FT                   FQLGVTAICFLVLLNSGIYDSPESTLDHAMFQAVSISTTAGFATQSFSEWPLFLPILLI
FT                   LASFIGGCAGSTGGGMKVVRIVLLLKQGGREVKRLIHPRAMYAIRLNNKAVGDRVIDAV
FT                   WGFFAAYAGLFALFMVALIATGMDDITAFSATVACLNNLGPGLGAVASHFGDITDTAKW
FT                   LLVLAMLFGRLEIFTLLVLFSPAFWKS"
     atggaatacc ggaccataac ccggatcatc ggcctgttgg tggcgctgtt cagtaccacc        60
     atgctgcctc cggccctgat tgccgtgatc tataaagacg gaggcggtac caccttcgtt       120
     caggcctttg tgctctcctt agtattgggg ctgctgctct ggtaccccaa tcgtgatgcc       180
     aaacaggagc ttcgctcacg cgaaggcttc cttattgtgg tgctgttctg gacggtactg       240
     ggctccatcg gtgcaatccc gctggtgctg gcggactctc ctaacctcag ctttaccgac       300
     gccatgtttg aggccttctc ggccctgacc acaaccggcg ccacggtgat caccggactg       360
     gataacctgc ccaaagcgat cctgttctac cgccacctgc tgcaatggct cggcggcatg       420
     gggatcattg tattggcggt cgcggtactg ccgatgctgg gcgttggtgg catgcagctg       480
     tatcgctgtg agacgccggg gccggtcaaa gacaacaaga tgacgccgcg catcgctgag       540
     accgccaagg cgctgtggta catctacctg acgctgacta tcgcctgtgc actggcgtac       600
     tggctggcgg gaatgaacct gtttgatgcg gtaggccacg ccttttccac cgtatccatc       660
     ggtggcttct ccagttacga tgccagtatg ggccactttg acagtcggct gatcaacgcc       720
     atctgtgtgg tgttcctgct gattgcgggg gtgaatttca gcctccactt taccgccttc       780
     ggtcgtcgtg gcgtcaacct gaagacctac ttccgcgaca ccgaagtgaa ggtgttcctc       840
     ggcttccagc tgggggttac tgcgatctgc ttcctggtac tgctgaacag cggcatctac       900
     gattctccgg aatccaccct ggaccacgcc atgttccagg cggtatcgat ctccaccacc       960
     gccggcttcg ccacccagag cttctccgag tggccgctgt tcctgcccat tctgctgatc      1020
     ctggccagtt ttattggtgg ctgtgccggc tcgaccggtg gcggcatgaa ggtggtgcgc      1080
     attgtgttgc tgctgaagca gggcggacgt gaggtgaagc gcctgatcca cccccgggcg      1140
     atgtacgcca tccgcctgaa caacaaggcg gtgggcgacc gggtgattga tgcggtgtgg      1200
     ggcttctttg ccgcttacgc tggcctgttt gccctcttta tggtggcgct gatcgccacc      1260
     ggcatggatg acatcaccgc gttcagtgcc accgtggcct gtctgaataa cctgggcccg      1320
     ggtctggggg cggtggccag tcactttggt gacattaccg atacggcaaa atggttgctg      1380
     gtattggcca tgctgtttgg ccgactggag attttcacgc tgctggtgct gttctcaccg      1440
     gcgttctgga agagctga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page