(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE151

CP002209.PE151       Location/Qualifiers
FT   CDS_pept        174670..175305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0151"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647; KEGG: slo:Shew_3708 TetR family
FT                   transcriptional regulator; PFAM: regulatory protein TetR;
FT                   SPTR: A2V3L4 Transcriptional regulator, TetR family; PFAM:
FT                   Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74365"
FT                   /db_xref="GOA:E1SW65"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW65"
FT                   /protein_id="ADN74365.1"
FT                   /translation="MKTKDRIIEASCELFNEHGERAVTTNHIAAHLGISPGNLYYHFRN
FT                   KEQIIRALFAQYEAYLEEAYGPSDDETAFGVMKRYLDGMFEGMWRFRFLYASLPEILAR
FT                   DPELHKRYLQAHHRVLETATNNLRMLKAQGMMVIDDAYLDEFAEGIKMVVTFWISHLYT
FT                   QALDKPITEQGVSQGVLQILAMFHGYIAEPARADFERLVAHYRALAHG"
     atgaaaacca aagatcgcat cattgaggcc agttgcgagc tctttaacga gcacggcgaa        60
     cgggccgtca ccaccaatca tattgccgcg catctgggca tcagcccggg caatctgtac       120
     taccacttcc gcaataaaga gcagatcatc cgggccctgt ttgcccagta tgaggcttac       180
     ctggaggagg cgtacggccc cagcgacgac gagaccgcgt tcggcgtgat gaagcgctac       240
     ctcgacggga tgttcgaagg gatgtggcgc tttcgctttc tgtacgccag cctgccggag       300
     atcctggccc gtgacccgga actgcacaaa cgttacctgc aggcccacca ccgggtactg       360
     gaaaccgcca ccaataacct gcggatgctg aaggcccagg ggatgatggt gattgatgat       420
     gcttatctgg atgagtttgc cgagggcatc aagatggtgg tcaccttctg gatcagtcac       480
     ctttacaccc aggctctgga taagcccatc actgagcagg gcgtgtctca gggcgtactg       540
     cagattttgg ccatgttcca cggttatatt gcggagccgg cccgcgccga cttcgagcgc       600
     ctggtggcgc attaccgggc tttggcccac ggttga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page