(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE154

CP002209.PE154       Location/Qualifiers
FT   CDS_pept        177809..178069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74368"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW68"
FT                   /protein_id="ADN74368.1"
FT                   /translation="MRRSLAMLLLLLSLPLCGLRVVECHVALPSERGISIETNTPETLT
FT                   APPFFLPSLTQPALTPRYPGLPLPTYLEPLPRAHFRPPIVA"
     atgcggcgct cactcgcgat gctgttgttg ttgctcagcc tgcctttgtg tgggctaagg        60
     gtcgttgagt gtcatgtggc cttaccatcc gagcggggca tcagtatcga aaccaacaca       120
     cccgagacac tgaccgctcc cccgtttttt ctgccctctt tgacccagcc cgcgctgacg       180
     ccgcgctacc cggggctgcc actgcccacc taccttgaac ctctgccaag ggcccatttc       240
     cgtcctccga tcgtggcgtg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page