(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE160

CP002209.PE160       Location/Qualifiers
FT   CDS_pept        181023..181451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0285 hypothetical protein; SPTR:
FT                   A2UXS0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74374"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY0"
FT                   /protein_id="ADN74374.1"
FT                   /translation="MDMKLSPMRLFSTLMLVVALISQGAVARVHLMPDMSPAEMSAMHA
FT                   HHEMAASTSQHDGMAHCKAQSVATHDCCESMAQPDDCHDANAPCNGECGMCKVFSPAGV
FT                   ALLTTALQPWQPSPERALPQPKFFHSVALSQDSKPPIA"
     atggacatga aactttcccc gatgcgactg ttcagcactt tgatgctggt tgttgccctg        60
     atcagtcagg gtgcggttgc tcgtgtccat ttgatgcccg atatgagccc ggccgagatg       120
     agcgccatgc acgcccatca cgagatggcg gcttcaacct cccaacatga tgggatggcc       180
     cactgcaaag cgcagtccgt cgctacccat gactgttgtg agtcgatggc tcagcccgac       240
     gattgtcacg atgccaacgc accctgtaat ggcgagtgcg gcatgtgcaa agtgttcagt       300
     cccgctggtg ttgctctgct gaccacagcc ctgcaaccct ggcaaccctc ccctgagcgc       360
     gccctgcctc agcccaagtt tttccattct gtggccctgt ctcaggacag caagccgccc       420
     atagcctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page