(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE161

CP002209.PE161       Location/Qualifiers
FT   CDS_pept        181581..182132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0161"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR007087; KEGG: sse:Ssed_0212 hypothetical
FT                   protein; SPTR: A3T2Y6 Copper-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74375"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY1"
FT                   /protein_id="ADN74375.1"
FT                   /translation="MTKLYSRAVAVFALALSLTLSPLALANMGHHGDHAAHQAQEAQHC
FT                   PHGKQDGERKGCCGQAKGESCPHAGKGHAAHQGDTHACPMHPKVTGVAGDDCPKCGMKL
FT                   EQVAQADTHVCPMHPKVTGVAGDDCPKCGMKLEQMAQADTHVCPMHPKVTGVAGDDCPK
FT                   CGMKLEPKRGQGGHGHHAHH"
     atgaccaagc tgtactcccg tgccgtggcg gtgttcgccc tggccctttc tctgactctg        60
     tctcccctgg cgctggccaa catggggcat catggcgacc atgccgcgca ccaggcgcaa       120
     gaggcccagc actgcccgca tggcaagcag gatggcgagc gcaaaggctg ctgcggccag       180
     gccaaaggcg agtcctgccc tcacgccggt aagggccatg ctgcccatca gggcgatacc       240
     cacgcctgcc ctatgcaccc caaggtgacc ggtgtggccg gtgacgactg tccgaagtgc       300
     ggcatgaagc tggagcaggt tgcccaggcg gacacccacg tgtgcccgat gcaccccaag       360
     gtgaccggtg tggctggcga cgactgcccg aagtgcggca tgaagctgga gcagatggct       420
     caggctgata cccacgtttg cccgatgcac ccgaaggtga ctggtgtggc tggcgacgat       480
     tgccccaagt gcggcatgaa gctggagcct aagcgcggtc agggtggtca cggccaccac       540
     gcgcaccact aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page