(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE163

CP002209.PE163       Location/Qualifiers
FT   CDS_pept        183908..187054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0163"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="COGs: COG3696 Putative silver efflux pump; InterPro
FT                   IPR001036: IPR017871: IPR004763; KEGG: spl:Spea_3989 CzcA
FT                   family heavy metal efflux protein; PFAM: acriflavin
FT                   resistance protein; SPTR: A2UXS3 Heavy metal efflux pump,
FT                   CzcA family; TIGRFAM: heavy metal efflux pump, CzcA family;
FT                   PFAM: AcrB/AcrD/AcrF family; TIGRFAM: heavy metal efflux
FT                   pump (cobalt-zinc-cadmium)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74377"
FT                   /db_xref="GOA:E1SKY3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY3"
FT                   /protein_id="ADN74377.1"
FT                   /translation="MLEKIISASLRQRAMVLVITAVLAIYGWQAMRTTPLDALPDLSDV
FT                   QVIIKTAYPGQAPQLVEDQITYPLSTAMLAVPGAQTVRGFSMFGDSFVYVIFEDGTDIY
FT                   WARSRVLEYLSQIQGQLPPGVTPSLGPDASGVGWVFQYALVDRTGHQDLAQLRSLQDWF
FT                   IKLELQSVAGVSEVATVGGMEKAYQIVVDPHKLALYQLDLMAVKQALDNANASVGGSVI
FT                   EMAEAEYMITASGYRQTLQDFEEIPLGIVSESGTPVLMKDVAQLRTGPAARRGIAELDG
FT                   QGEVVGGIVVMRYGENALATIDNVKAKLAEIESGLPEGVELVITYDRSQLILNAVDNLK
FT                   NKVIEEMVVVALVCLVFLLHARSTLVAVITLPLSILASFIVMGWMGVNANIMSLGGIAI
FT                   AIGAVVDAAIVMVENAHKHLEHYREEHGKAPEGDAHWQLIKEAAVEVGPALFFSLLIIT
FT                   LSFIPVFALEAQEGRLFHPLAYTKTFAMAASAILAITLIPVLMGYFVRGKIPDEQKNPI
FT                   SRFLIALYQPVLKLVLRFPKVTLMLAVVALASAYYPMSKMGSEFMPELEEGDLLYMPTT
FT                   LPGVSAGKAGEILQQTDRLIKTIPEVARVFGKVGRADTATDPAPLTMLETTIMLKPRSE
FT                   WREGQTMEGIIADLQRTVKVPGITNAWVQPIKTRIDMLSTGVRTPVGVKISGADVEELQ
FT                   RIGAEVEAILAPLPGTTSAFAQRTGGGRYLDIDPKLTVAARYGMTLRDVQDVVQMAIGG
FT                   MTMGESIQGQERYPINIRYPRELRDDIEKLRNLPVLTKTGKYVPLQTLADLSIRDGAPM
FT                   LASENGRLISWVFVDIDSSVLSIGEYITQAREAMNQQLQLPPRYSVSFAGQYEYMQRVE
FT                   AKMEMVIPMMLAVIFLLLMMTFGSVVQASIIMLSLPFALVGSAWLLFGLGYNLSVAVAV
FT                   GMIALAGVAAEFGVVMQVYLNNTIKAHEKKGLMRHEQDLKDALIEGAVMRIRPKAMTVA
FT                   TIFFGLLPIMWGSGTGNEVMQKIAAPMVGGMVTAPLLSLFVIPAIYLLIYRRGLAKADA
FT                   "
     atgttagaga aaatcatcag cgcctccctg cgtcagcggg cgatggtgct ggtcatcacc        60
     gcggtgttgg ccatctatgg ctggcaggcg atgcgcacca caccgctgga cgcgctgccg       120
     gacctgtccg atgtgcaggt gatcatcaaa accgcctacc cggggcaggc gcctcagttg       180
     gtggaagacc agatcaccta tccgctctct accgccatgc tggcggtgcc cggcgcgcag       240
     accgtgcgtg gcttctccat gtttggggac agcttcgttt acgtcatctt tgaagatggt       300
     accgacatct actgggcccg ctcgcgggtg ttggagtacc tgtcccagat ccaggggcaa       360
     ctgcccccgg gcgtcacccc ctctctgggg ccggacgcct ccggtgtggg ctgggtgttc       420
     cagtatgcgc tggtggatcg caccggccac caggacctgg cccagctgcg ctcgctgcag       480
     gattggttta tcaagctgga gctgcagagc gtcgccggtg tctccgaagt ggcgaccgtc       540
     ggtggcatgg aaaaggcgta tcagattgtg gtggatcccc acaaactggc gctctatcag       600
     cttgacctga tggcggtgaa gcaagccctc gataacgcca acgcctccgt gggtggctca       660
     gtgatcgaga tggcggaagc ggagtacatg atcaccgcgt ccggctaccg ccagaccctc       720
     caggattttg aggagatccc actgggcatc gtgtccgagt ccggcacgcc ggtactgatg       780
     aaggacgtgg cccagctgcg caccggcccg gcggcccgcc gtggcattgc cgaactggat       840
     ggccagggtg aagtggtggg cggcatcgtg gtgatgcgct atggcgagaa cgccctggcc       900
     accatcgaca acgtcaaagc caaactcgct gagattgaat ccggtctgcc cgaaggggtg       960
     gagctggtga tcacctatga ccgttcccag ctgatcctga acgccgtgga caacctcaag      1020
     aacaaggtga ttgaggagat ggtggtggtg gcgctggtgt gcctggtgtt cctgctgcat      1080
     gcccgctcca cgctggtggc ggtgatcacc ctgccgttgt cgattctggc cagcttcatt      1140
     gtaatgggct ggatgggggt gaacgccaac atcatgagcc tcggcggcat cgccatcgcc      1200
     attggtgcgg tggtggacgc ggccattgtg atggtggaga acgcccacaa acacctggag      1260
     cactaccggg aggagcacgg caaggcgccg gaaggcgatg cccactggca gttgatcaag      1320
     gaagcggcgg tcgaagttgg gcctgcgctg ttcttcagcc tgttgatcat caccctgagc      1380
     tttattccgg tgtttgcgct ggaggctcag gaggggcgtc tgttccaccc gttggcctac      1440
     accaaaacct ttgccatggc ggcctcggcc atcctggcga tcaccctgat cccggttttg      1500
     atgggctact ttgtgcgggg caagatcccg gatgagcaga aaaaccccat cagccgcttc      1560
     ctgatcgcgc tttatcagcc ggtactgaag ctggtgctgc gcttccccaa ggtcactctg      1620
     atgttggccg tggtggctct ggccagcgcc tactacccga tgagcaagat gggttccgag      1680
     tttatgccgg agctggagga gggcgacctg ctctacatgc ccaccacgct gccgggggtg      1740
     agtgccggta aggcggggga gatcctgcag cagaccgatc gactgatcaa aaccatcccg      1800
     gaagtggcca gagtgttcgg caaagtggga cgggcggaca ccgcgaccga cccggcaccg      1860
     ctgaccatgc tggaaaccac catcatgctc aagccccgct ctgagtggcg cgaggggcag      1920
     acgatggaag ggatcattgc ggatctgcag cgcaccgtaa aagtgccggg gatcaccaat      1980
     gcctgggtgc agccgatcaa aacccgcatc gacatgctct ccaccggcgt gcgaacgccg      2040
     gtgggggtga agatctccgg cgcggacgtg gaagagctgc agcgcatcgg cgccgaagtg      2100
     gaagcgattc tggccccgct gccgggcacc acctccgcgt ttgcccaacg gaccggcggt      2160
     ggccgctatc tggatatcga ccccaagctg accgtggcgg cccgttacgg catgacgctg      2220
     agagacgtgc aggacgtagt tcagatggcg attggcggca tgaccatggg ggaatcgatc      2280
     caaggtcagg agcgctatcc catcaatatc cgctaccccc gtgagttgcg tgacgacatc      2340
     gagaagctgc gtaacctgcc ggtgctgacc aaaaccggca agtatgtccc gctgcaaact      2400
     ctggcggacc tctccatccg ggatggtgcc ccgatgctgg cgagcgagaa tggccgtctg      2460
     atctcctggg tattcgtgga catcgacagc agtgtcctct ccatcggtga gtacatcacc      2520
     caggctcgtg aagcgatgaa ccagcagctg caactgccgc ctcgctactc cgtcagcttt      2580
     gccggtcagt acgagtacat gcagcgggtg gaagccaaga tggagatggt gatcccgatg      2640
     atgctggcgg tgattttcct gctgctgatg atgacctttg gctcggtggt tcaggccagc      2700
     atcatcatgc tcagcctgcc gtttgctctg gtggggtctg cctggctgct gtttggtctg      2760
     ggctacaacc tctccgtggc cgtggccgtg gggatgatcg ccctggcggg ggtggccgca      2820
     gagtttggtg tggtgatgca ggtgtatctg aacaacacca tcaaagccca tgagaagaag      2880
     ggcctgatgc gccatgagca ggatctgaaa gacgccctga ttgaaggggc ggtgatgcgg      2940
     atccggccca aggcgatgac cgtggccacc atcttctttg gtctgctgcc gatcatgtgg      3000
     ggcagcggta ccggtaacga ggtgatgcag aagatcgcgg cacccatggt gggtggcatg      3060
     gtgacggctc cgttgctgtc gctgttcgtg atcccggcca tctacctgtt gatctaccgt      3120
     cggggattgg ccaaagccga tgcctga                                          3147
//

If you have problems or comments...

PBIL Back to PBIL home page