(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE165

CP002209.PE165       Location/Qualifiers
FT   CDS_pept        187605..188210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_4292 hypothetical protein; SPTR:
FT                   A3IDJ3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74379"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY5"
FT                   /protein_id="ADN74379.1"
FT                   /translation="MKKLTLTALLVLGLSACGQSETAKQAEAFSALDHKAAVLQGHQWY
FT                   KNNDGIVVRVHPDRVNATFSDGTEADVAIPNGEFYLSIAPWATFTHPCGNHVPTGCTGE
FT                   LIGQPMHVSAVDVDSGEEVINKMITTQHDGFIDFWVPAQRQLAFTFHFDHPKYGMLEAK
FT                   EVLPTFEDSRTCITTMQLKPMDGGAIEAPGQGGHSGHH"
     atgaagaaac tgacgctgac cgcccttttg gttctggggc tgagcgcctg tggacagagt        60
     gaaaccgcca aacaagccga ggccttttcg gcactcgacc ataaggcggc agtactgcag       120
     ggacaccagt ggtacaaaaa caacgatggg attgtggttc gggttcatcc tgaccgggtg       180
     aatgccacgt tttctgatgg caccgaagcg gatgttgcca ttccgaacgg ggagttctac       240
     ctctcaatcg ccccctgggc gacctttacc catccctgcg gcaaccacgt gcccaccggc       300
     tgcaccggtg agctgattgg ccagccgatg cacgtcagtg ccgtggatgt ggacagtggt       360
     gaggaggtca tcaataagat gatcaccacc caacacgatg gctttatcga tttctgggtg       420
     ccggctcagc gccaactggc cttcaccttc cactttgacc atcccaagta cggcatgctg       480
     gaagcgaaag aggtgctgcc cacctttgag gacagccgca cctgcatcac caccatgcag       540
     cttaagccga tggatggcgg tgccatagaa gcacctggac agggtggtca tagcggccat       600
     cactaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page