(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE167

CP002209.PE167       Location/Qualifiers
FT   CDS_pept        190016..190510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74381"
FT                   /db_xref="GOA:E1SKY7"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY7"
FT                   /protein_id="ADN74381.1"
FT                   /translation="MQVMAKYLQNVQSRMVISLVMARVLGLMLLALSAMELYRSLGDGD
FT                   VALALMAFTQLYHLTLGLMLLTLAIRLVKQVGQMRLFSVACRQMMVMLARLGLLAAFLV
FT                   KPCGLIVISAVQPELAMDITFLKFVMLVDWPVVVLAGLLHLMAGLQKLGSEMNAEQELT
FT                   I"
     atgcaagtga tggcgaagta cctgcagaac gtgcagagcc gaatggtgat ttccctggtg        60
     atggcccggg tgcttggcct gatgttgctg gccctgtccg caatggagct ttatcgcagc       120
     ctgggggacg gcgatgtggc gttggcgctg atggccttta ctcagcttta tcacctgacc       180
     ctggggttga tgctgctgac cctggcgatt cggctggtga agcaggtggg ccagatgcgc       240
     ttattcagtg tggcctgccg ccagatgatg gtgatgctgg cgcggctggg gttgttggcg       300
     gcgtttctgg tgaagccctg tgggttgatc gtcatctcgg cagtccagcc ggaactggcc       360
     atggacatca ctttcctgaa gtttgtgatg ctggtggatt ggccggtagt ggtactggcg       420
     ggcctgttgc acctgatggc cgggctgcaa aagctgggca gcgagatgaa cgcggagcag       480
     gagctgacca tctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page