(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE168

CP002209.PE168       Location/Qualifiers
FT   CDS_pept        190510..190734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0168"
FT                   /product="transcriptional regulator"
FT                   /note="COGs: COG3655 transcriptional regulator protein;
FT                   InterPro IPR001387; KEGG: swp:swp_4005 helix-turn-helix
FT                   motif protein; PFAM: helix-turn-helix domain protein;
FT                   SMART: helix-turn-helix domain protein; SPTR: A3I7K2 YozG;
FT                   PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74382"
FT                   /db_xref="GOA:E1SKY8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY8"
FT                   /protein_id="ADN74382.1"
FT                   /translation="MPIVIHLDVMLAKRKMKLNELAAQIGITPQNLSVLKAGRAKAIRF
FT                   STLEAICDALGCQPGDILEFEQGEEDGTD"
     atgccgattg tcatccatct ggatgtgatg ctggctaagc gcaagatgaa gttgaacgag        60
     ctggcggcgc agattggcat cacaccccaa aacctcagtg tgctgaaagc ggggcgcgcc       120
     aaagcgatcc ggttcagcac gctggaagcg atttgcgatg cgttgggttg ccagcctggt       180
     gacattctgg agtttgagca gggagaggaa gatgggaccg attga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page