(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE169

CP002209.PE169       Location/Qualifiers
FT   CDS_pept        190721..191242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aav:Aave_2025 choline/carnitine/betaine
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74383"
FT                   /db_xref="GOA:E1SKY9"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY9"
FT                   /protein_id="ADN74383.1"
FT                   /translation="MGPIEIQREIAGHDVKVEVSMWSGRERVLIDGEEVSNTLSWRFTT
FT                   LHQLVLDGRPFEVEVSIQNLWDGRLGVVFRLDGETVGVTRWALSSEASEESDEETNWLA
FT                   DWRLPGWLSALFWLPYLGLIVADMVATFTDQEALLGTVIPPALLLLGALGVALSLTTWI
FT                   RGMTLPTGPN"
     atgggaccga ttgagataca gcgtgagatc gccggccatg atgtgaaagt ggaagtcagc        60
     atgtggagcg gccgcgagcg ggtgctgatc gatggtgaag aggtcagcaa caccttgagt       120
     tggcgcttta ccaccttgca tcaactggtg ttggatgggc ggccatttga ggtggaagtg       180
     tcgattcaga atctctggga tggccgcctt ggcgtggtgt ttcgtctgga tggggagacc       240
     gttggtgtca cccgctgggc gctcagcagc gaagccagtg aggagagtga cgaggagacc       300
     aactggctgg cggactggcg cttgcccggt tggctgagtg cactgttctg gttgccctac       360
     ctggggctta ttgtggccga tatggtggcg acctttaccg atcaggaggc gctgcttggc       420
     accgtgattc caccggcgct gttgctgctt ggggcgctgg gcgtggcatt aagcctcacc       480
     acctggatcc ggggcatgac cctgcccacc ggcccgaact ag                          522
//

If you have problems or comments...

PBIL Back to PBIL home page