(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE177

CP002209.PE177       Location/Qualifiers
FT   CDS_pept        198157..199077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0177"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR001972:
FT                   IPR001107: IPR018080; KEGG: ttu:TERTU_1892 SPFH/band 7
FT                   domain protein; PFAM: band 7 protein; SMART: band 7
FT                   protein; SPTR: P0AA56 Protein qmcA; PFAM: SPFH domain /
FT                   Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74391"
FT                   /db_xref="GOA:E1SKZ7"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ7"
FT                   /protein_id="ADN74391.1"
FT                   /translation="MFGSEIVALVLVGLAVILVATGVKMVPQGFQYTVERFGKFTRTLS
FT                   PGLNLIVPLVDTIGKKQNMMEQVLDIMPQEVISADNAQVTTDAVCFYQVQDPVRASYEV
FT                   NNLELAMQNLVMTNIRAVLGAMELDEMLSNRDRINAELLIKVDEATDPWGVKVTRIEIR
FT                   DISPPRDLVDAMARQMKAEREKRAAILEAEGEREAAIKVAEGEKQSAILKAEGQLEAAK
FT                   REAEARERLAEAEAAATTMVSKAIAEGDMQAINYFVAQKYVEAVKEVASAENSKLVMMP
FT                   LEAGNLIGAVGGISELLKETGKRSV"
     atgtttggta gcgaaattgt cgcgctggtg ctggttggcc tggcggtgat tctggtggcc        60
     accggggtca agatggtgcc gcaggggttc cagtacacgg tggaacggtt tggcaagttc       120
     acccgcacgt tgtcgcccgg actgaacctg atcgtgccgc tggtggacac catcggcaag       180
     aaacagaaca tgatggagca ggtgctcgac atcatgccgc aggaggtgat ctccgcagac       240
     aacgcccagg tcaccaccga tgcggtctgt ttctaccagg tgcaggaccc ggttcgcgcc       300
     tcttacgagg tgaacaacct ggaactggcg atgcagaacc tggtgatgac caacatccgt       360
     gcggtgctgg gggcgatgga gctggatgag atgctctcca accgcgaccg catcaacgct       420
     gagctgctga ttaaggtgga cgaagccacc gatccctggg gcgtcaaagt cacccgcatc       480
     gagattcggg acatcagccc gccccgcgac ctggtggacg ccatggcccg ccagatgaaa       540
     gcggaacggg aaaagcgcgc cgccattctg gaagcggaag gggagcgtga agcggccatt       600
     aaggtagcgg agggcgagaa gcaatccgcc atcctcaaag cggaaggtca gctcgaggcg       660
     gccaagcgtg aggcggaagc gcgggagcgt ctggccgaag cggaagcggc cgccaccacc       720
     atggtgtcca aagcgatcgc tgaaggggat atgcaggcca taaactattt tgtggcgcag       780
     aagtacgtgg aagccgttaa agaggtggcc tcggcggaaa acagcaagct ggtgatgatg       840
     ccactggagg cgggcaacct gatcggcgcc gttggcggca tcagtgagtt gctgaaagag       900
     accggaaaaa ggagcgtctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page