(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE178

CP002209.PE178       Location/Qualifiers
FT   CDS_pept        199077..199526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0178"
FT                   /product="protein of unknown function DUF107"
FT                   /note="COGs: COG1585 Membrane protein implicated in
FT                   regulation of membrane protease activity; InterPro
FT                   IPR002810; KEGG: cja:CJA_1077 hypothetical protein; PFAM:
FT                   protein of unknown function DUF107; SPTR: A3H0N8 Putative
FT                   uncharacterized protein; PFAM: NfeD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74392"
FT                   /db_xref="GOA:E1SKZ8"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ8"
FT                   /protein_id="ADN74392.1"
FT                   /translation="MAVLEALEAWHWLVLGLILLGLEALGAGGFLLGAAAAGILLSLLM
FT                   WIWPEMGWSLQLMVFALSAVLFTVIYWRGFRRFNQATEQPQLNDRAAQLVGRVLVLEHD
FT                   LLPGEGKIQVGDTLWRARTEQPLAAGSRVRIVASEGMVLQLEAAQ"
     atggcggtac tggaagcgct ggaagcctgg cactggctgg tgctggggct gatcctgctg        60
     ggattggagg cgttgggcgc cggcggtttt ctgctggggg cggcagcggc gggcatcctg       120
     ttgtcgttgc tgatgtggat ctggccggag atgggctggt cgctgcagct gatggtgttc       180
     gccttgagcg cggtgctgtt caccgtgatc tactggcgcg gcttccgccg ctttaaccag       240
     gccactgagc agccgcaact gaatgatcgc gctgcgcagt tggtggggcg ggtgctggtg       300
     ctggagcacg acctgctgcc tggcgagggc aagatccagg ttggtgatac cctgtggcgg       360
     gcccgcaccg agcagccgtt ggctgccggt tcccgggtaa ggattgtggc cagtgagggg       420
     atggtgctgc agctggaggc ggcgcaatga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page