(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE180

CP002209.PE180       Location/Qualifiers
FT   CDS_pept        200533..201531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0180"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="COGs: COG4783 Putative Zn-dependent protease
FT                   contains TPR repeats; InterPro IPR001915; KEGG:
FT                   har:HEAR0989 hypothetical protein; PFAM: peptidase M48
FT                   Ste24p; SPTR: A3RU87 Zinc metalloprotease; PFAM: Peptidase
FT                   family M48"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74394"
FT                   /db_xref="GOA:E1SL00"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL00"
FT                   /protein_id="ADN74394.1"
FT                   /translation="MQLSGQWLDGQQSRSAHGVLRVAADGALYRDGQGQPFAELAELTI
FT                   PARLGSMPRTLVLANGWRFVCDQHEALDQLMQRQGRQGLRLVDRMERSGRAVLIGTLLV
FT                   IGGAFGAYQYGVPALAQSTAEALPDDLLDEMSQQALYELPLDRSELPLARQQQIRDGFV
FT                   RLLRANELNPSDFRLHLRSAPKIGPNAFALPSGDIVLLDQLVALTDHDDQWLGVLAHEL
FT                   VHVEARHGLRGVLQGAYGALLVTLMTGDASAATGPLVELPRILLESGYSRDMEREADAL
FT                   GAEMLRRAGGDPAQLAVMFERLAEQGSSELPGWLRSHPDHDERIKALRESN"
     atgcaactga gtggacagtg gttggatggt caacagagtc gcagcgctca cggcgtgttg        60
     cgggtggccg cggatggcgc gctgtatcgt gacgggcagg gccagccctt tgctgagctg       120
     gccgaactga ccataccggc gcggttgggc agcatgccgc gcaccctggt gttggccaat       180
     ggctggcgct ttgtctgtga ccagcacgag gcgctggacc aactgatgca gagacagggg       240
     cgccagggcc tgcgtctggt ggaccggatg gagcgcagtg gccgggcggt gttgattggc       300
     accctgctgg tgatcggcgg cgcgtttggc gcctaccaat acggggtgcc ggcattggcg       360
     caatctaccg ctgaagcgct tcctgatgac ctgctcgacg agatgtcaca acaggcgctg       420
     tatgagttgc cgttagaccg aagcgagttg ccactggccc ggcagcagca gatccgggat       480
     gggtttgtcc gcttgctgcg cgccaatgag ctgaaccctt cagacttccg tctgcacctg       540
     cgcagtgcgc caaaaattgg gcccaacgcc tttgccctgc ccagtggtga cattgtgtta       600
     ctcgaccagc tagtggcgct gactgaccac gacgatcagt ggcttggggt gctggcgcat       660
     gagttggtgc atgtggaggc gcggcatgga ctgcgcggag tgctgcaggg cgcctacggg       720
     gcgctgctgg tgaccctgat gaccggtgat gccagtgccg ccaccggccc gctggtcgag       780
     ttgccgagga ttctgctgga gagtggctat agccgggata tggagcgcga ggccgatgcg       840
     cttggcgctg agatgctgcg ccgggccgga ggggatccgg cccagctggc ggtgatgttt       900
     gagcgactgg ccgaacaggg gagcagtgag ttgccgggtt ggctgcgcag tcaccctgac       960
     cacgatgaac ggatcaaagc cctgcgcgag tccaactag                              999
//

If you have problems or comments...

PBIL Back to PBIL home page