(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE183

CP002209.PE183       Location/Qualifiers
FT   CDS_pept        204987..205610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0183"
FT                   /product="SOS-response transcriptional repressor, LexA"
FT                   /EC_number="3.4.21.88"
FT                   /note="COGs: COG1974 SOS-response transcriptional
FT                   repressors (RecA-mediated autopeptidase); InterPro
FT                   IPR006197: IPR006199: IPR019759: IPR006200; KEGG:
FT                   slo:Shew_0127 LexA repressor; PFAM: LexA DNA-binding domain
FT                   protein; Peptidase S24/S26A/S26B, conserved region; PRIAM:
FT                   Repressor lexA; SPTR: A3Q951 LexA repressor; TIGRFAM: LexA
FT                   repressor; PFAM: LexA DNA binding domain; Peptidase
FT                   S24-like; TIGRFAM: SOS regulatory protein LexA"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74397"
FT                   /db_xref="GOA:E1SL03"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL03"
FT                   /protein_id="ADN74397.1"
FT                   /translation="MKPLTPRQNQVFDLVRQHMQDTGMPPTRAEIARQLGFKSANAAEE
FT                   HLKALARKGFIEIVPGTSRGIRLLYNEPEPEQLGLPLIGRVAAGEPILAQEHVETHYQM
FT                   DGNLFRPSANYLLRVRGDSMKEIGILDGDLLAVHQTQDARNGQVVVARVGEDEVTVKRF
FT                   ERRGNVVYLHAENAEYEPIVVDLEDTALAIEGLAVGVVRNGGWQ"
     atgaagccac ttacgccccg ccagaatcag gtgttcgatc tggttcgcca gcatatgcag        60
     gacaccggga tgcccccgac ccgggccgag attgcccggc agctgggttt taagagtgcc       120
     aacgcggcgg aagagcacct taaggcgctg gcccgtaaag gctttattga gattgtccct       180
     ggtacctccc gcggcatccg tctgctctac aacgagccgg agccggagca gttgggcctg       240
     ccgctgattg gccgggtggc cgccggtgag ccgattctgg ctcaggagca tgtggaaacc       300
     cactaccaga tggatggcaa cctgttccgt ccgtccgcca actacctgtt gcgggtgcgc       360
     ggtgactcca tgaaggagat cggcatcctc gacggcgacc tgttggcagt gcaccagact       420
     caggatgccc gcaatggtca ggtggttgtg gcccgggtgg gtgaagatga agtgaccgtc       480
     aagcggttcg agcgtcgcgg caacgtggtg tatctgcacg cggaaaacgc ggagtacgag       540
     ccgattgtcg tggatctgga agacaccgcg ctggccattg aaggcctggc ggttggcgtg       600
     gttcgcaacg gaggatggca gtaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page