(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE188

CP002209.PE188       Location/Qualifiers
FT   CDS_pept        209771..210643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0188"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="COGs: COG1845 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 3; InterPro IPR000298; KEGG: swp:swp_4826
FT                   cytochrome c oxidase, subunit III; PFAM: cytochrome c
FT                   oxidase subunit III; PRIAM: Cytochrome-c oxidase; SPTR:
FT                   A0Y469 Cytochrome c oxidase subunit III; PFAM: Cytochrome c
FT                   oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74402"
FT                   /db_xref="GOA:E1SL08"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL08"
FT                   /protein_id="ADN74402.1"
FT                   /translation="MSQHERYYVPAQSPWPIVGAVGLFLIALGAGNYVASLSKGGGMGG
FT                   YVLLAGIAVILFMMVGWFRNVIDESMSGLYSRQMDRSFRQGMSWFIFSEVMFFAAFFGA
FT                   LFYARMVAIPWLGGAGNNAMTSEVLWPAFEAVWPLETTPDGTQTQAMGWSGLPLYNTII
FT                   LVISSVTLHVAHVGLEQNKRKVLTGWLGLTILLGAAFLFLQVEEYVHAYNEMGLTLDAG
FT                   IYGNTFFLLTGFHGMHVTLGTIMLIVMFFRVLKGHFTPENHFGFQATSWYWHFVDVVWI
FT                   CLFVFVYVL"
     atgagtcaac acgaacgtta ttacgtaccg gcccagagcc cctggcccat tgtcggtgcg        60
     gtagggctgt tcctgattgc cctgggggct ggcaactatg tggccagcct gtccaaaggg       120
     ggcggcatgg gcggctatgt gctgctggcc ggcatcgccg tcatcctgtt tatgatggtg       180
     ggctggttcc gcaatgtgat tgatgagtcg atgtccgggc tctattcacg ccagatggac       240
     cgctcgttcc gacaggggat gagctggttt atcttctccg aagtgatgtt ctttgccgcc       300
     ttcttcggcg cgctgtttta cgcccggatg gtggccatcc cctggctggg cggggcgggt       360
     aacaacgcca tgaccagtga ggtgctgtgg ccagcgtttg aagcggtctg gccgctggaa       420
     accacgccag acggtaccca gacccaggcg atgggctgga gtggcctgcc gctctacaac       480
     accatcatcc tggtgatctc ctcggttacg ctgcatgtgg ctcacgttgg acttgagcag       540
     aacaagcgca aggtgctgac cggctggctg ggcctgacca ttctgctggg cgcggctttc       600
     ctgtttctgc aggttgagga gtacgtccac gcctacaacg agatggggct gaccctcgac       660
     gccggcatct acggcaacac cttctttctg ctgaccggct tccacggcat gcacgtgacg       720
     ctgggcacca tcatgttgat cgtgatgttc ttccgggttc tgaaagggca tttcaccccg       780
     gaaaaccact tcggtttcca ggccaccagc tggtattggc actttgtgga tgtggtgtgg       840
     atctgcctgt tcgtcttcgt ctacgtactt tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page