(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE190

CP002209.PE190       Location/Qualifiers
FT   CDS_pept        210935..211672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3346 conserved hypothetical protein;
FT                   InterPro IPR002994; KEGG: saz:Sama_3488 hypothetical
FT                   protein; SPTR: A2V2H2 Putative uncharacterized protein;
FT                   PFAM: SURF1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74404"
FT                   /db_xref="GOA:E1SL10"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL10"
FT                   /protein_id="ADN74404.1"
FT                   /translation="MSQPVRPAIWAALIATVLAIGVLVKLGFWQLDRAEEKRHLMAQLA
FT                   QRAEQTLHWPLPDWPGEQLAGYRLAGTVEPVTERTLLLDNQTLDGQVGYRWLQPARFDG
FT                   GAWILLDLGFVPVARGDRTLPTLPTLPERLSVSGRLYRPGHNPLNAHLLPEAGSVTRIQ
FT                   ALELAQLSDHWQQPVAPVVWLVEQPELVGFARSWQPINLSPEKHQGYALQWFGLAVALV
FT                   IILLRMIQIGRLQRSAQADRLET"
     atgagccaac cagtacgtcc tgcaatctgg gctgccctga tagccactgt gctggccatc        60
     ggcgtcctgg tcaagttggg gttctggcag ctggaccgcg ccgaggagaa gcggcacctg       120
     atggcgcagt tggcgcagcg ggctgagcag accctccact ggcctctgcc ggactggccc       180
     ggtgagcaac tggcgggtta ccggctggcg ggcaccgtcg agccggtaac agagcggact       240
     ctgctgctgg ataaccagac tctggatggg caggtgggtt accgctggct gcaaccggcg       300
     cgctttgatg gcggagcctg gatcctgctc gacctcggtt ttgtcccggt ggcacggggg       360
     gatcgcaccc tgccaacgtt gccgacgctg cccgagaggc tcagtgtcag cggccgcttg       420
     taccggcccg gccacaatcc actcaatgcc catctgctgc cggaagcggg ttctgtcacc       480
     cgtatccagg cgctggaact ggcgcagctc agtgatcatt ggcaacagcc ggtggcgccg       540
     gtggtgtggc tggtagaaca gcctgaactg gtgggttttg cccgttcatg gcagcccatc       600
     aacctcagtc cggagaaaca tcagggctat gccctgcagt ggttcggtct ggccgtggcg       660
     ctggtcatca ttctgttgag gatgattcag attggtcgct tgcaacggtc tgctcaggcc       720
     gataggttgg aaacataa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page