(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE192

CP002209.PE192       Location/Qualifiers
FT   CDS_pept        212293..213249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0192"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="COGs: COG1612 Uncharacterized protein required for
FT                   cytochrome oxidase assembly; InterPro IPR003780; KEGG:
FT                   swp:swp_4835 cytochrome oxidase assembly; PFAM: cytochrome
FT                   oxidase assembly; SPTR: A2V2H4 Cytochrome oxidase assembly;
FT                   PFAM: Cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74406"
FT                   /db_xref="GOA:E1SL12"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL12"
FT                   /protein_id="ADN74406.1"
FT                   /translation="MKKLTFATLCLTFVVILLGAFTRLTDAGLGCPDWPGCYGFLTVPS
FT                   AEHVEVAEARFPERPVEVAKAWAEMVHRYVAGTLGLFIFALALLSLKSNGPKGLPWLLV
FT                   GLVLFQAALGMWTVTLNLLPVVVMGHLMGGFAIFSLLFLLWLRQSDNAIELSPLRVLAT
FT                   VALVVLLGQIMLGGWTSANYAALVCTQLPICEGDWMGNLAPLDAFHPLPPPAESYEFGV
FT                   LDYPARMTIHVSHRIGAVITALVLLWLWWRLRQSGANRVAAVLGTVLLVQVALGVTNVV
FT                   GSLPLPVAVAHNGVAALLLLTLVWINHLAWQRPAKEG"
     atgaagaaac tgacgtttgc tactctctgc ctcacctttg tggtgattct gctgggggcc        60
     tttacccgac tgaccgacgc gggcctgggg tgtccggact ggccgggctg ctatggtttt       120
     cttacggtgc cctcagccga gcacgtggag gtggccgaag cccgcttccc ggagcgcccg       180
     gttgaagtgg ccaaggcctg ggcagagatg gtgcatcgct acgtggcggg caccctgggg       240
     ctgtttatct ttgccctggc gctgctgtcg ctgaaatcca atggcccgaa agggctgccc       300
     tggctgctgg tggggctggt gctgtttcag gcggcgctgg ggatgtggac cgtcaccctg       360
     aacctgttgc cggtggtggt gatggggcac ctgatgggcg ggtttgccat cttcagcctg       420
     ctgttcctgc tctggctgcg gcaaagcgat aacgccatcg aactgtcgcc cctgcgtgtg       480
     ctggccacgg tggcactggt ggtgctgttg ggacagatca tgctgggggg ctggacctcc       540
     gccaactatg cggcattggt ctgtactcag ctgcccatct gcgaggggga ctggatgggc       600
     aatttggcgc cgcttgacgc gtttcatccg ttgccgcctc cggcagagag ttatgagttt       660
     ggggtactgg actatccggc ccgcatgacc atccacgtga gtcatcgtat cggcgcggtg       720
     atcaccgcgt tggtgctgct gtggctctgg tggcgtctgc gtcaaagcgg agccaaccgg       780
     gttgcggccg tgctgggcac cgtcctgctg gtgcaggtcg cgctgggtgt gaccaatgtg       840
     gttggctcgc tgccgctgcc ggtggctgtg gcgcacaacg gagtggcagc actgctgctg       900
     ctgactctgg tttggatcaa tcatctggcc tggcagcgac cggccaagga ggggtaa          957
//

If you have problems or comments...

PBIL Back to PBIL home page