(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE194

CP002209.PE194       Location/Qualifiers
FT   CDS_pept        214152..214796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0194"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="COGs: COG1999 Uncharacterized protein SCO1/SenC/PrrC
FT                   involved in biogenesis of respiratory and photosynthetic
FT                   systems; InterPro IPR003782; KEGG: pat:Patl_4237 electron
FT                   transport protein SCO1/SenC; PFAM: electron transport
FT                   protein SCO1/SenC; SPTR: A2V2H6 Electron transport protein
FT                   SCO1/SenC; PFAM: SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74408"
FT                   /db_xref="GOA:E1SL14"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL14"
FT                   /protein_id="ADN74408.1"
FT                   /translation="MKASNQWIVLLGLVALVAGLSLSLKGPAPRPEVSALWLEQARPLP
FT                   EFSLTDHNGQPFDRARLEGQWSLFFVGYTSCPDVCPTTMSDLARVYPKLEERLGEKPVQ
FT                   VVLLSVDPGRDDPEKLGQYVEFFRPGFMAVTGEHAQLFPFTQSLGLVYALVDNPNGGEY
FT                   LVDHSADLVLINPEGAIEAFFRPSGELGTLRKVSMAQLEQDLPVIIGAYSG"
     atgaaggcgt cgaaccaatg gattgtgttg ctggggctgg tggctctggt ggcggggctg        60
     tccctgagcc tgaagggccc cgcgccgcgt ccggaggtgt cggcactgtg gctggagcag       120
     gcgcggccac tgccggagtt ctccctgacc gaccacaacg gccagccctt tgaccgtgcg       180
     cggctggagg ggcagtggag tttgtttttc gtgggctaca cctcctgtcc ggacgtgtgc       240
     cccaccacca tgtcggatct ggcccgggtc tatcctaagc tggaggagcg gcttggcgag       300
     aagccggtgc aggtggtgtt gctgtcggtc gaccccggcc gggatgaccc ggagaagctg       360
     ggtcagtatg tcgagttctt ccggcccgga tttatggcgg tgaccggtga acacgcccag       420
     ctgtttccct ttacccagtc gctggggctg gtctacgccc tggtggacaa ccccaatggt       480
     ggcgagtatc tggtggacca ctccgccgac ctggtgctga tcaatcctga aggggcgatt       540
     gaggcgttct tccgccccag tggtgaactg ggcaccctgc gcaaagtatc gatggcgcag       600
     ctggagcagg acctgccggt gatcatcggg gcgtactcag gttga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page