(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE196

CP002209.PE196       Location/Qualifiers
FT   CDS_pept        215928..217265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0196"
FT                   /product="MATE efflux family protein"
FT                   /note="COGs: COG0534 Na+-driven multidrug efflux pump;
FT                   InterPro IPR002528; KEGG: swd:Swoo_0160 MATE efflux family
FT                   protein; PFAM: multi antimicrobial extrusion protein MatE;
FT                   SPTR: A2V2H8 MATE efflux family protein; TIGRFAM: MATE
FT                   efflux family protein; PFAM: MatE; TIGRFAM: putative efflux
FT                   protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74410"
FT                   /db_xref="GOA:E1SL16"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL16"
FT                   /protein_id="ADN74410.1"
FT                   /translation="MTVTAILRQWEGHRRTFMLALPMILSNVTIPLLGLVDTAVIGHLS
FT                   DAYYLGGVAVGAMIITFLFWILGFLRMATTGLVAQSFGAGDALGQLRVLYQAGVMALGL
FT                   AALLLLLQAPILSMALTLVGGSSEVQHYAAVYFEVRIWSAPAALLNLVLLGYLLGRQNP
FT                   RAAMWLLLCTNGVNIALDLLFVVGFGWGVAGAAGASVIADYGALLLALALVWHSLPDEL
FT                   RQRATLAQLSLEGSGRLLALNRDIFIRTLCLQLCMAFVTAQGARLGDAVVAANSVLMNF
FT                   TLLMAYALDGFAYAAEAEVGRSSGARDRDGIRRAVVLGGFWSALTALAFTLVFAGAGEG
FT                   IIAMLTSIDSVRSTAAEYLPWVVIYPLLAFTCFLFDGVYIGAARGAAMRNSMLCSALGF
FT                   FALWWLVRDSLPGNHALWLAFCGFITLRSLSLPGHFLWSWRRGQWG"
     atgacggtca ccgccatctt gcggcagtgg gaggggcatc gtcgcacctt catgctggca        60
     ctgccgatga tcctgtccaa tgtcactatc cccttgttgg ggctggtgga tacggccgtg       120
     atcggccatc tgagcgacgc ctactatctc ggtggcgtgg ccgttggcgc catgattata       180
     acctttttgt tttggattct gggatttttg cggatggcca ccacggggtt ggtggcgcag       240
     tcgtttggcg ccggggatgc cttagggcag ttgcgggtgc tgtaccaggc cggagtgatg       300
     gcgctggggc tggccgccct attgttgctg ttgcaagcgc cgattctgtc gatggccctg       360
     accctagtgg ggggcagcag cgaagtccag cactatgccg cggtgtactt cgaggtgcgg       420
     atctggtctg ccccggcggc actgctcaac ctggtgctgc tgggttacct gttgggccgg       480
     cagaacccgc gggcggcgat gtggctgctg ctgtgcacca acggcgtcaa catcgccctc       540
     gacctgctgt ttgtggtggg gttcggctgg ggcgtggccg gtgccgccgg ggccagtgtg       600
     atcgccgatt acggtgcgct gctgctggcg ttggcgctgg tgtggcactc cctgcctgac       660
     gagttacgac aacgcgccac tctggctcaa ctgtcgctcg agggcagcgg ccgcctgctg       720
     gcgctcaacc gcgacatctt tatccgtacc ctctgcctgc agctgtgcat ggcgtttgtc       780
     accgcccagg gggcccggct gggagacgcg gtggtggccg ccaactcggt gctgatgaac       840
     ttcaccctgc tgatggccta tgcgctggat ggctttgctt acgcggcgga agcggaagtg       900
     gggcgttcca gcggcgcacg ggatcgggat ggcatccgtc gggctgtggt gctgggggga       960
     ttctggtcgg ccctgacggc gctggcgttt accctggtgt ttgccggggc gggcgagggc      1020
     atcatcgcca tgctaaccag catcgacagc gtccgcagca cggcggcaga gtacctgccc      1080
     tgggtggtga tctacccgct gctggcgttt acctgtttcc tgtttgatgg ggtttacatc      1140
     ggcgctgccc gcggcgcggc catgcgcaac agcatgcttt gttcggcgct gggatttttt      1200
     gccctgtggt ggctggtgcg cgactccctg ccaggcaacc atgccctgtg gctggcgttc      1260
     tgcggcttta tcaccctgcg cagcctgagc ctgccgggcc actttctctg gagctggcga      1320
     cggggccagt ggggctga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page